| Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261442.1 | Gene: | Blimp-1 / 38638 | FlyBaseID: | FBgn0035625 | Length: | 1216 | Species: | Drosophila melanogaster |
| Alignment Length: | 199 | Identity: | 61/199 - (30%) |
|---|---|---|---|
| Similarity: | 85/199 - (42%) | Gaps: | 20/199 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 SILCPEVKDLPMPSAEKVSAPTSLNHQKSIG-----------GGTGPYVCPDCGRIINNKSNFQE 159
Fly 160 HTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRN 224
Fly 225 ERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHK--RKEEKL 287
Fly 288 TELA 291 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | |
| C2H2 Zn finger | 144..164 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 186..211 | CDD:290200 | 11/24 (46%) | ||
| UFD2 | <256..>294 | CDD:227443 | 12/38 (32%) | ||
| C2H2 Zn finger | 258..280 | CDD:275368 | 7/21 (33%) | ||
| Blimp-1 | NP_001261442.1 | SET | 133..260 | CDD:214614 | |
| C2H2 Zn finger | 892..912 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 904..929 | CDD:290200 | 9/26 (35%) | ||
| C2H2 Zn finger | 920..940 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 932..957 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 948..968 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 960..985 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 976..996 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 1004..1023 | CDD:275368 | 7/18 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45457167 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||