DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and scrt

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster


Alignment Length:185 Identity:52/185 - (28%)
Similarity:75/185 - (40%) Gaps:18/185 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGI-----KNFHC 172
            |.:..|:|.....||. :.||:      .|.|.:||:.....||...|...|..:     |..| 
  Fly   445 KHVADPAAAASGVPTP-DQQKT------KYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCH- 501

  Fly   173 VFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSF 237
               .|.:::.:...|..|...|  :..:.|..|.:.||.....|.|.|.|..|:.|.|..|.|:|
  Fly   502 ---TCGKAYVSMPALAMHLLTH--KLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAF 561

  Fly   238 VSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEEKLTELAI 292
            .....||.|...|...:|..|..|.|.|...|:|..||.|...|.:||.:..:::
  Fly   562 ADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLESACLKDEEELMMSMSL 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 3/21 (14%)
zf-H2C2_2 186..211 CDD:290200 6/24 (25%)
UFD2 <256..>294 CDD:227443 12/37 (32%)
C2H2 Zn finger 258..280 CDD:275368 9/21 (43%)
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275370 6/19 (32%)
C2H2 Zn finger 500..520 CDD:275368 4/23 (17%)
COG5048 520..>617 CDD:227381 32/99 (32%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..562 CDD:290200 9/22 (41%)
C2H2 Zn finger 554..574 CDD:275368 7/19 (37%)
zf-C2H2 554..574 CDD:278523 7/19 (37%)
zf-H2C2_2 566..590 CDD:290200 8/23 (35%)
C2H2 Zn finger 582..599 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.