DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF773

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_940944.1 Gene:ZNF773 / 374928 HGNCID:30487 Length:442 Species:Homo sapiens


Alignment Length:157 Identity:54/157 - (34%)
Similarity:83/157 - (52%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRI 193
            :.||: :..|..||.|.:||::.::|||...|.:.|||.:.:.|  .:|.:||:...:|..|.|:
Human   207 VQHQR-LHTGEKPYECSECGKLFSHKSNLFIHQIVHTGERPYGC--SDCGKSFSRNADLIQHQRV 268

  Fly   194 HTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYC 258
            ||||:|:.|..|.:.|..:....:|||.|...|.|||..|.|.|..:..|.||:.:|...|.:.|
Human   269 HTGEKPFTCSECGKAFRHNSTLVQHHRIHTGVRPYECSECGKLFSFNSSLMKHQRVHTGERPYKC 333

  Fly   259 YVCQKHFKRISHLMTHLSSNIHKRKEE 285
            ..|.|.:...|.|:.|...:..:|..|
Human   334 SECGKFYSHKSSLINHWRVHTGERPYE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:290200 11/24 (46%)
UFD2 <256..>294 CDD:227443 8/30 (27%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
ZNF773NP_940944.1 KRAB 15..75 CDD:214630
KRAB 15..54 CDD:279668
C2H2 Zn finger 153..169 CDD:275368
C2H2 Zn finger 193..213 CDD:275368 2/6 (33%)
zf-H2C2_2 206..230 CDD:290200 8/23 (35%)
COG5048 <209..438 CDD:227381 54/155 (35%)
C2H2 Zn finger 221..241 CDD:275368 7/19 (37%)
C2H2 Zn finger 249..269 CDD:275368 7/21 (33%)
zf-H2C2_2 261..286 CDD:290200 11/24 (46%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..325 CDD:275368 7/19 (37%)
zf-H2C2_2 317..342 CDD:290200 8/24 (33%)
C2H2 Zn finger 333..353 CDD:275368 6/19 (32%)
C2H2 Zn finger 361..381 CDD:275368 54/157 (34%)
zf-H2C2_2 373..397 CDD:290200
C2H2 Zn finger 389..409 CDD:275368
zf-H2C2_2 401..426 CDD:290200
C2H2 Zn finger 417..437 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.