DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and CG11906

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:302 Identity:63/302 - (20%)
Similarity:113/302 - (37%) Gaps:42/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSRSDAPIDLFGPGNGHLVRQIHSITGVELSC----KKEISGQMCTTCLDNLQAAIKFRQRC 66
            |.:|   :|.:|.......|     |:|...:...    :::.:||...|.......:::.|.| 
  Fly   288 CDLC---EAQLDTKYEWEMH-----HTICQAKQEALAIVEQQEAGQTVMTSRVPRACSMRSRSR- 343

  Fly    67 IIAEKQNLERIECDSKDCSTDPIIYEDIDDNQIES---ELDESILCPEVKDLPMPSAEKVSAPTS 128
              |..:..:|.:.|.::        ||.:|.:|||   ||:|.     .:|.........:....
  Fly   344 --ACSEAWDRYDMDEEE--------EDEEDEEIESGGEELEEG-----EEDAMYARRMNFTGDWI 393

  Fly   129 LNHQKSIGGGTG--PYVCPDCGRIINNKSNFQEHTL-------RHTGIKNFHCVFLNCERSFATR 184
            :||.:|.....|  ..:..|.|.:..:.:..:|:.|       ....:|:|.|...:|.....|.
  Fly   394 VNHSRSNSNSAGNLSLLYGDYGMVETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTL 458

  Fly   185 KELTSHTRI-HTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKM 248
            ..|..|..: |.....:.|..|...|:|. ...::|...:|...|.|..|::.|.....|.:|..
  Fly   459 VALMKHDYMEHWKMSWFYCHKCGDVFTSK-VFLDYHMHLQNRGLYICHKCREEFELQHQLDRHFQ 522

  Fly   249 IHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRKEEKLTEL 290
            :|....|::|..|:..|...:.|:.|.....|...:|.|..:
  Fly   523 LHRKGINYHCNFCRLEFLSEAKLLAHCKKLGHSPNDEPLISI 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 13/73 (18%)
C2H2 Zn finger 144..164 CDD:275368 4/26 (15%)
C2H2 Zn finger 172..194 CDD:275368 5/22 (23%)
zf-H2C2_2 186..211 CDD:290200 6/25 (24%)
UFD2 <256..>294 CDD:227443 8/35 (23%)
C2H2 Zn finger 258..280 CDD:275368 5/21 (24%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.