DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and CG1603

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster


Alignment Length:220 Identity:61/220 - (27%)
Similarity:86/220 - (39%) Gaps:33/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QRCIIAEKQNLERIECDSKDCSTDPIIYEDIDDNQIESELD---ESILCPEVKDLPMPSAEKVSA 125
            |:|...|.|.|:.........|...::|.|..|.:...:.:   ..:...||.||          
  Fly   392 QKCSKQEVQYLQMCSFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVKAHEVGDL---------- 446

  Fly   126 PTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSH 190
                           ||:|..|.|..:...:...|.||....:...|.:  ||:|||...:|..|
  Fly   447 ---------------PYLCSFCPRRFDRHVDMDRHKLRSHFERKLKCQY--CEKSFAVDTDLKVH 494

  Fly   191 TRIHTGEQPYVCVYCPRRFSSSGARQEHHRR--HRNERRYECDTCKKSFVSSGCLRKHKMIHVDA 253
            |.|||||:|:||..|.:.|... ...:||..  |.|.|.|.|:.|.|:|.....|..|...|::.
  Fly   495 TLIHTGERPHVCDICGKTFRLK-LLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNI 558

  Fly   254 RNHYCYVCQKHFKRISHLMTHLSSN 278
            |:..|..|...|...|.|..|..|:
  Fly   559 RDKKCEYCDATFYDHSSLSRHRRSH 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 5/11 (45%)
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 9/21 (43%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 7/23 (30%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916 5/15 (33%)
C2H2 Zn finger 420..441 CDD:275368 2/20 (10%)
COG5048 <424..583 CDD:227381 52/186 (28%)
C2H2 Zn finger 450..471 CDD:275368 6/20 (30%)
C2H2 Zn finger 478..498 CDD:275368 9/21 (43%)
zf-H2C2_2 490..513 CDD:290200 12/22 (55%)
C2H2 Zn finger 506..527 CDD:275368 5/21 (24%)
C2H2 Zn finger 535..555 CDD:275368 6/19 (32%)
C2H2 Zn finger 563..583 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.