DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and Cf2

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:362 Identity:76/362 - (20%)
Similarity:122/362 - (33%) Gaps:125/362 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSRSDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTC---------LDNLQAAI- 60
            |.:||       ::|         |||.|......|....|.:|||.         ::..:||: 
  Fly   157 CLMCS-------IYG---------IHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAVT 205

  Fly    61 -------------------KFRQRCIIAE--------------KQNLERIECDSKDCSTDPIIYE 92
                               :..|:.:.||              :|..|.:|...::      :.|
  Fly   206 PDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQRE------MQE 264

  Fly    93 DIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGT-----------GPYVCPD 146
            .....|:.....:..|..:...|.:|       |.::...|:..||.           .|....|
  Fly   265 QAQQQQVHHHQQDQDLAGDQVALKVP-------PLTVKLNKNANGGAIVSHPQVIIKEEPLSLSD 322

  Fly   147 CGRIINNKSNFQ--------------------------EHTLRHTGIKNFHCVFLNCERSFATRK 185
            .|.::|:...:.                          .|.:||      .|.  :|.::|.|..
  Fly   323 SGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRH------KCP--DCPKTFKTPG 379

  Fly   186 ELTSHTRIHTG-------EQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCL 243
            .|..|.:||||       |:||.|.||.:.|:.|...::|.|.|..|:.:.|..|:|||.....|
  Fly   380 TLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYL 444

  Fly   244 RKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIH 280
            .||...|...:.:.|..|.|.|.:.|.|..| ::.:|
  Fly   445 TKHIRTHTGEKPYTCPYCDKRFTQRSALTVH-TTKLH 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 19/112 (17%)
C2H2 Zn finger 144..164 CDD:275368 4/45 (9%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 13/31 (42%)
UFD2 <256..>294 CDD:227443 8/25 (32%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 37/114 (32%)
C2H2 Zn finger 368..388 CDD:275368 6/21 (29%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 8/24 (33%)
C2H2 Zn finger 459..480 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.