DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and zld

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:105/268 - (39%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCIIAEKQNLERIECDSKDCSTDP 88
            |....|..::|.:.......:|....|..|:...|.:....:....|:..::..:.|..      
  Fly  1203 GQQEAQTPTLTVLSTPYSPTVSSSRATPALEMDMATLMQHHQDYEMEQYQMQHQQLDQM------ 1261

  Fly    89 IIYEDIDDNQIESELDESILCPEVKDL-PMPSAEK-----VSAPTSLNHQKSIGGGTGPYVCPDC 147
                .....|::.:..:.||..:.:.: ..|.|:|     .:..|:...:.|..|.|.|:     
  Fly  1262 ----QQHQQQLDHQQQQQILADQTQTMAQQPLAKKRRGGNATPSTTKRRRNSSVGSTSPH----- 1317

  Fly   148 GRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTR-IHTGEQPYVCVYCPRRFSS 211
                       ..||....||   |  |.|::.|.....||.|.: .|:||.|:.|..|.:||.|
  Fly  1318 -----------STTLPSGRIK---C--LECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQS 1366

  Fly   212 SGARQEHHRRHR-NERRYECDTCKKSFVSSGCLRKH-KMIHVDARNHYCYVCQKHFKRISHLMTH 274
            ......|..||| .::.::|:.|.|.|.....||:| :.||...:.|.|.:|:|.|.|..||..|
  Fly  1367 EDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKH 1431

  Fly   275 LSSNIHKR 282
            |.:  |.|
  Fly  1432 LET--HNR 1437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 8/51 (16%)
C2H2 Zn finger 144..164 CDD:275368 2/19 (11%)
C2H2 Zn finger 172..194 CDD:275368 7/22 (32%)
zf-H2C2_2 186..211 CDD:290200 11/25 (44%)
UFD2 <256..>294 CDD:227443 12/27 (44%)
C2H2 Zn finger 258..280 CDD:275368 9/21 (43%)
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 21/62 (34%)
C2H2 Zn finger 1328..1349 CDD:275368 7/22 (32%)
C2H2 Zn finger 1357..1377 CDD:275368 6/19 (32%)
C2H2 Zn finger 1386..1407 CDD:275368 7/20 (35%)
zf-H2C2_2 1398..1422 CDD:290200 9/23 (39%)
zf-C2H2 1413..1435 CDD:278523 10/23 (43%)
C2H2 Zn finger 1415..1435 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.