DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and CG11696

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:333 Identity:77/333 - (23%)
Similarity:110/333 - (33%) Gaps:101/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNCRICSRSDAPIDLFGPGNGHLVRQIHSITGV----------------ELSCKKEISGQMCTTC 52
            |:|.||:   ||::.|.....|. |..|..||.                .|.|.|:.....|.:|
  Fly   300 LDCAICA---APLEDFNDLKRHF-RVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSC 360

  Fly    53 LDN-------LQAAIKFR-------QRCIIAE---------------KQNLERIE-CDSKDCSTD 87
            ..|       :...::|.       .:|.|.|               .:..||.| ||:  ||. 
  Fly   361 RKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDT--CSK- 422

  Fly    88 PIIYEDIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIIN 152
                                        ...:..::||.....|....    .|.:|..||....
  Fly   423 ----------------------------TFRTKFELSAHVKRMHAADF----TPIICDICGTHFR 455

  Fly   153 NKSNFQEH--TLRHTG-IKNFHCV----FLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFS 210
            :|:||..|  .|...| :....|.    :|..|||.  ||.|..|.. ..|:..|.|:.|....|
  Fly   456 SKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSL--RKHLARHDD-RDGDTKYRCLLCNAEKS 517

  Fly   211 SSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHL 275
            |..|...|.|.|.:.:|::|..|.|.|.....|.:|...|.....:.|..|.:.||      :|.
  Fly   518 SRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFK------SHA 576

  Fly   276 SSNIHKRK 283
            :.:.||:|
  Fly   577 NMHNHKKK 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 21/114 (18%)
C2H2 Zn finger 144..164 CDD:275368 8/21 (38%)
C2H2 Zn finger 172..194 CDD:275368 9/25 (36%)
zf-H2C2_2 186..211 CDD:290200 6/24 (25%)
UFD2 <256..>294 CDD:227443 8/28 (29%)
C2H2 Zn finger 258..280 CDD:275368 5/21 (24%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 1/16 (6%)
C2H2 Zn finger 357..378 CDD:275368 3/20 (15%)
C2H2 Zn finger 388..408 CDD:275368 3/19 (16%)
C2H2 Zn finger 417..438 CDD:275368 6/51 (12%)
C2H2 Zn finger 447..465 CDD:275368 7/17 (41%)
C2H2 Zn finger 478..498 CDD:275368 8/21 (38%)
C2H2 Zn finger 509..529 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.