Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001091884.1 | Gene: | ZNF621 / 285268 | HGNCID: | 24787 | Length: | 439 | Species: | Homo sapiens |
Alignment Length: | 251 | Identity: | 66/251 - (26%) |
---|---|---|---|
Similarity: | 100/251 - (39%) | Gaps: | 58/251 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MRILNCRICSRSDAPIDLFGPGNGHLVRQIHSITGVE-LSCKKEISGQMCTTCLDNLQAAIKFRQ 64
Fly 65 RCIIAEKQNLERIECDSKDCSTDPIIYEDIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSL 129
Fly 130 NHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIH 194
Fly 195 TGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIH 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 18/70 (26%) |
C2H2 Zn finger | 144..164 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 12/24 (50%) | ||
UFD2 | <256..>294 | CDD:227443 | |||
C2H2 Zn finger | 258..280 | CDD:275368 | |||
ZNF621 | NP_001091884.1 | KRAB | 11..71 | CDD:214630 | |
COG4049 | 145..198 | CDD:226535 | 17/69 (25%) | ||
C2H2 Zn finger | 153..173 | CDD:275368 | 6/26 (23%) | ||
zf-H2C2_2 | 166..190 | CDD:316026 | 9/36 (25%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 5/54 (9%) | ||
zf-H2C2_2 | 221..246 | CDD:316026 | 8/24 (33%) | ||
C2H2 Zn finger | 237..257 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 265..285 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 281..302 | CDD:316026 | 12/20 (60%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 308..329 | CDD:316026 | 9/20 (45%) | ||
C2H2 Zn finger | 321..341 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |