DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZSCAN1

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006723212.1 Gene:ZSCAN1 / 284312 HGNCID:23712 Length:448 Species:Homo sapiens


Alignment Length:175 Identity:47/175 - (26%)
Similarity:67/175 - (38%) Gaps:44/175 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PSAEKVSA-------------PTSLNH-----QKSIGG---------GTGPYVCPDCGRIINNKS 155
            |||:::|.             ..||.|     |:::.|         |..|:.|.|||.:....:
Human   281 PSAQRISPRRRNRNTDQSGRHQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVT 345

  Fly   156 NFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHR 220
            :|.||...|.....|.|.  .|.:.|.....||.|.:||..|.|.  ...||   |.|.|:....
Human   346 HFIEHQKTHREEGPFPCP--ECGKVFLHNSVLTEHGKIHLLEPPR--KKAPR---SKGPRESVPP 403

  Fly   221 RH--------RNERR-YECDTCKKSFVSSGCLRKHKMIHVDARNH 256
            |.        |:.:| ::|..|.|:|.....|..|:.:|. |..|
Human   404 RDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHT-AHGH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 1/1 (100%)
C2H2 Zn finger 258..280 CDD:275368
ZSCAN1XP_006723212.1 SCAN 75..162 CDD:280241
C2H2 Zn finger 334..354 CDD:275368 7/19 (37%)
zf-H2C2_2 346..371 CDD:290200 8/26 (31%)
C2H2 Zn finger 362..382 CDD:275368 6/21 (29%)
C2H2 Zn finger 422..442 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.