DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZKSCAN5

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001305011.1 Gene:ZKSCAN5 / 23660 HGNCID:12867 Length:839 Species:Homo sapiens


Alignment Length:313 Identity:80/313 - (25%)
Similarity:132/313 - (42%) Gaps:58/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRICSRSDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQM---CTTC----------LDNLQ 57
            |::|.::...       :.||| |.||:.          ||:.   |..|          :::|:
Human   404 CQVCGKAFRV-------SSHLV-QHHSVH----------SGERPYGCNECGKNFGRHSHLIEHLK 450

  Fly    58 AAIKFR-QRC---------IIAEKQNLERIECD---SKDCSTDPIIYEDIDDN-QIESELDESIL 108
            ...:.: |||         :..:|:..|..|.|   |.....:....:|..:. :.:.:||....
Human   451 RHFREKSQRCSDKRSKNTKLSVKKKISEYSEADMELSGKTQRNVSQVQDFGEGCEFQGKLDRKQG 515

  Fly   109 CPEVKDLPMPSAEKVS-APTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHC 172
            .|..:.|..||::::: :.....|:|| ..|..|:.|.:||:.....::..:|...|||.|.|.|
Human   516 IPMKEILGQPSSKRMNYSEVPYVHKKS-STGERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRC 579

  Fly   173 VFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSF 237
            .  .|.:|:..|..||.|.|:||||:||.|..|.:.|.......:|...|..||.::|:.|.|.|
Human   580 E--ECGKSYNQRVHLTQHQRVHTGEKPYTCPLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGF 642

  Fly   238 VSSGCLRKHKMIHVDARNHYCYVCQKHF----KRISHLMTHLSSNIHKRKEEK 286
            .....|..|..:|...::|.|..|.:.|    ..|.|.:.|:.     :|.||
Human   643 GRRSHLAGHLRLHSREKSHQCRECGEIFFQYVSLIEHQVLHMG-----QKNEK 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 17/92 (18%)
C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 10/35 (29%)
C2H2 Zn finger 258..280 CDD:275368 6/25 (24%)
ZKSCAN5NP_001305011.1 SCAN 46..155 CDD:128708
SCAN 47..134 CDD:280241
KRAB 222..257 CDD:279668
COG5048 318..762 CDD:227381 80/313 (26%)
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
zf-H2C2_2 388..411 CDD:290200 2/6 (33%)
C2H2 Zn finger 404..424 CDD:275368 8/27 (30%)
C2H2 Zn finger 432..452 CDD:275368 3/19 (16%)
zf-C2H2 549..571 CDD:278523 4/21 (19%)
C2H2 Zn finger 551..571 CDD:275368 4/19 (21%)
zf-H2C2_2 563..588 CDD:290200 9/26 (35%)
C2H2 Zn finger 579..599 CDD:275368 8/21 (38%)
zf-H2C2_2 591..614 CDD:290200 12/22 (55%)
C2H2 Zn finger 607..627 CDD:275368 4/19 (21%)
zf-H2C2_2 619..644 CDD:290200 8/24 (33%)
C2H2 Zn finger 635..655 CDD:275368 6/19 (32%)
C2H2 Zn finger 663..683 CDD:275368 5/19 (26%)
zf-C2H2 717..739 CDD:278523
C2H2 Zn finger 719..739 CDD:275368
C2H2 Zn finger 747..795 CDD:275368
COG5048 758..>823 CDD:227381
zf-C2H2 773..795 CDD:278523
zf-H2C2_2 787..811 CDD:290200
C2H2 Zn finger 803..823 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.