Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012458.1 | Gene: | ZSCAN23 / 222696 | HGNCID: | 21193 | Length: | 389 | Species: | Homo sapiens |
Alignment Length: | 293 | Identity: | 76/293 - (25%) |
---|---|---|---|
Similarity: | 118/293 - (40%) | Gaps: | 49/293 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LVRQIHSITGVELSC----KKEISGQMCTTCLDNLQAAIKFRQRCIIAEKQNLERIECDSKDCST 86
Fly 87 DPIIYEDIDD--NQIESELDESI--LCP-----------------------EVKDL--------- 115
Fly 116 ---PMPS-AEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLN 176
Fly 177 CERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSG 241
Fly 242 CLRKHKMIHVDARNHYCYVCQKHFKRISHLMTH 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 9/53 (17%) |
C2H2 Zn finger | 144..164 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 11/24 (46%) | ||
UFD2 | <256..>294 | CDD:227443 | 6/19 (32%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 6/17 (35%) | ||
ZSCAN23 | NP_001012458.1 | SCAN | 44..156 | CDD:128708 | 12/66 (18%) |
SCAN | 45..132 | CDD:280241 | 9/39 (23%) | ||
COG5048 | <215..384 | CDD:227381 | 54/167 (32%) | ||
zf-C2H2 | 249..271 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 251..271 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 264..288 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 279..299 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 292..316 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 323..344 | CDD:290200 | 10/20 (50%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 348..372 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 6/17 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |