DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZSCAN25

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001337908.1 Gene:ZSCAN25 / 221785 HGNCID:21961 Length:544 Species:Homo sapiens


Alignment Length:161 Identity:52/161 - (32%)
Similarity:82/161 - (50%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRI 193
            :.||:: ..|..||||.:|.:..:.:.:.:.|...|||.|.:.|.  :|.:||:.|:.|..|.|.
Human   391 MKHQRT-HLGKRPYVCSECWKTFSQRHHLEVHQRSHTGEKPYKCG--DCWKSFSRRQHLQVHRRT 452

  Fly   194 HTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYC 258
            ||||:||.| .|.:.||.:.....|.|.|..|:.|.|..|.|.|.....|.:|:.||...:.::|
Human   453 HTGEKPYTC-ECGKSFSRNANLAVHRRAHTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHC 516

  Fly   259 YVCQKHFKRISHLMTHLSSNIHKRKEEKLTE 289
            ..|.:.|.:.|.|..|..:   :.::|.|.:
Human   517 PACGRSFNQRSILNRHQKT---QHRQEPLVQ 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 3/19 (16%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 8/34 (24%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
ZSCAN25NP_001337908.1 SCAN 38..136 CDD:322011
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..189
KRAB_A-box 231..>259 CDD:143639
COG5048 <324..532 CDD:227381 49/144 (34%)
C2H2 Zn finger 350..370 CDD:275368
C2H2 Zn finger 377..397 CDD:275368 2/6 (33%)
C2H2 Zn finger 405..425 CDD:275368 3/19 (16%)
C2H2 Zn finger 433..453 CDD:275368 8/21 (38%)
C2H2 Zn finger 461..480 CDD:275368 6/19 (32%)
C2H2 Zn finger 488..508 CDD:275368 6/19 (32%)
C2H2 Zn finger 516..535 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.