DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6813 and klf-3

DIOPT Version :9

Sequence 1:	NP_001163590.1	Gene:	CG6813 / 41396	FlyBaseID:	FBgn0037923	Length:	294	Species:	Drosophila melanogaster
Sequence 2:	NP_001022205.1	Gene:	klf-3 / 191713	WormBaseID:	WBGene00003480	Length:	315	Species:	Caenorhabditis elegans

Alignment Length:	139	Identity:	41/139 - (29%)
Similarity:	59/139 - (42%)	Gaps:	26/139 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   110 PEVK-DLPM---------------PSAEKVSAPTSLNHQKSI-GGGTGP-------YVC--PDCG 148
            |.:| ::||               ||:...|..:.|..:..| .....|       :.|  |.|.
Worm   174 PAIKMEIPMHPLPHNGELDSTRSSPSSTTSSERSPLQRKSRIESNKRNPTDKKFVVHACTYPGCF 238

  Fly   149 RIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSG 213
            :..:..|:.:.|...|:|.|.|.|.:.||...||...|||.|.|.|||::|:.|..|.|.|:.|.
Worm   239 KKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSD 303

  Fly   214 ARQEHHRRH 222
            ....|.:||
Worm   304 HLSLHMKRH 312

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6813	NP_001163590.1	zf-AD	6..76	CDD:285071
		C2H2 Zn finger	144..164	CDD:275368	5/21 (24%)
		C2H2 Zn finger	172..194	CDD:275368	10/21 (48%)
		zf-H2C2_2	186..211	CDD:290200	13/24 (54%)
		UFD2	<256..>294	CDD:227443
		C2H2 Zn finger	258..280	CDD:275368
klf-3	NP_001022205.1	C2H2 Zn finger	235..254	CDD:275368	4/18 (22%)
		C2H2 Zn finger	262..284	CDD:275368	10/21 (48%)
		zf-H2C2_2	276..301	CDD:290200	13/24 (54%)
		C2H2 Zn finger	292..312	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000