DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:242 Identity:68/242 - (28%)
Similarity:98/242 - (40%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MCTTC------LDNLQAAIKFRQRCIIAEKQNLERIECDSKDCSTDPIIYEDIDDNQIESELDES 106
            :|..|      ||.||...:.....:....|..:|:|.||.:.:   :|...|:|:...|:.|.|
 Worm     6 LCRDCSGAFHSLDELQRHEREEHETVEQGDQEEDRMEDDSDELA---MIKIKIEDSDFLSDTDSS 67

  Fly   107 ILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFH 171
            .|...              ||:.: :||..|..|.|.|.||            |.:         
 Worm    68 QLSMN--------------PTTPS-EKSSSGEKGRYECEDC------------HEM--------- 96

  Fly   172 CVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKS 236
                     ||.::||.:|.|||:||||:.|..|.:.|.:....::|...|..||.:.|..|.|:
 Worm    97 ---------FAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWHTGERSHVCPHCNKA 152

  Fly   237 FVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKRK 283
            |...|.|.:|.|||...|.|.|..|.|.|.....|..|:  .||:.:
 Worm   153 FFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHM--KIHQER 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 7/33 (21%)
C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 9/28 (32%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 10/49 (20%)
zf-H2C2_2 102..127 CDD:290200 13/24 (54%)
C2H2 Zn finger 118..138 CDD:275368 4/19 (21%)
C2H2 Zn finger 146..166 CDD:275368 8/19 (42%)
zf-H2C2_2 158..181 CDD:290200 10/22 (45%)
zf-C2H2 172..194 CDD:278523 7/23 (30%)
C2H2 Zn finger 174..194 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.