DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and Zscan5b

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_573467.2 Gene:Zscan5b / 170734 MGIID:2159640 Length:468 Species:Mus musculus


Alignment Length:160 Identity:50/160 - (31%)
Similarity:76/160 - (47%) Gaps:4/160 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PTSLNHQKSIG--GGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELT 188
            |.:...:|.:.  .|...:.|.:|.:....||.|..|...|||.:.|.|:.  |.::|....:|.
Mouse   308 PANPQPEKQVDSLAGQARFQCTECKKSFLYKSRFDLHQRSHTGERPFKCIL--CNKAFVQSSDLR 370

  Fly   189 SHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDA 253
            .|.|:||||:||:|..|...|:.....|.|.|.|..|:.:.|..|.:.|...|.|..|..||.:.
Mouse   371 VHQRVHTGEKPYMCEVCGMEFAHGSTLQGHSRVHTKEKPFVCKDCGQRFCHKGNLNVHFRIHCNL 435

  Fly   254 RNHYCYVCQKHFKRISHLMTHLSSNIHKRK 283
            |.:.|..|.|.|::......|:.:::.|||
Mouse   436 RPYVCKKCNKTFRQQGTWKRHMKTHLRKRK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 8/28 (29%)
C2H2 Zn finger 258..280 CDD:275368 5/21 (24%)
Zscan5bNP_573467.2 SCAN 33..117 CDD:153421
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
zf-H2C2_2 344..365 CDD:372612 8/22 (36%)
C2H2 Zn finger 356..376 CDD:275368 6/21 (29%)
zf-H2C2_2 368..393 CDD:372612 12/24 (50%)
C2H2 Zn finger 384..404 CDD:275368 6/19 (32%)
zf-H2C2_2 397..419 CDD:372612 7/21 (33%)
zf-C2H2 410..432 CDD:333835 6/21 (29%)
C2H2 Zn finger 412..432 CDD:275368 6/19 (32%)
zf-C2H2 438..460 CDD:333835 5/21 (24%)
C2H2 Zn finger 440..460 CDD:275370 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.