DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF550

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001264019.1 Gene:ZNF550 / 162972 HGNCID:28643 Length:422 Species:Homo sapiens


Alignment Length:143 Identity:57/143 - (39%)
Similarity:74/143 - (51%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVC 202
            |..||.|..|.:...::|.|..|...|||.|.|.|  ..||::|:.|..|..|..|||||:||.|
Human   283 GEKPYECSQCRKAFTHRSTFIRHNRTHTGEKPFEC--KECEKAFSNRAHLIQHYIIHTGEKPYDC 345

  Fly   203 VYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKR 267
            :.|.:.|..|....:|.|.|..|:.|||..|.|:|..|..|.:|.:||.....:.|..|.|.|||
Human   346 MACGKAFRCSSELIQHQRIHTGEKPYECTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKR 410

  Fly   268 ISHLMTHLSSNIH 280
            .|||:.|  ..:|
Human   411 RSHLLQH--QRVH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 11/25 (44%)
C2H2 Zn finger 258..280 CDD:275368 10/21 (48%)
ZNF550NP_001264019.1 KRAB 12..72 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..158
COG5048 <200..357 CDD:227381 31/75 (41%)
C2H2 Zn finger 205..225 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 261..281 CDD:275368
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
C2H2 Zn finger 317..337 CDD:275368 7/21 (33%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
zf-H2C2_2 357..382 CDD:404364 10/24 (42%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
zf-H2C2_2 385..410 CDD:404364 8/24 (33%)
C2H2 Zn finger 401..421 CDD:275368 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.