DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF560

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_689689.2 Gene:ZNF560 / 147741 HGNCID:26484 Length:790 Species:Homo sapiens


Alignment Length:214 Identity:59/214 - (27%)
Similarity:81/214 - (37%) Gaps:54/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHC------------------ 172
            ||.||:......|..||.|..||:.....|.|.||...|||.|.:.|                  
Human   360 PTHLNNHMQTHIGIKPYKCKHCGKTFTVPSGFLEHVRTHTGEKPYGCKECGKAFGTSAGLIEHIR 424

  Fly   173 ------VFL--NCERSFATRKELTSHTRIHTGEQPYV---------------------------- 201
                  .|.  :|.::|.:...|..|.|:|.||:||.                            
Human   425 CHAREKTFKCDHCGKAFISYPSLFGHLRVHNGEKPYEHKEYGKAFGTSSGVIEDRRSNTGQKRFD 489

  Fly   202 CVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFK 266
            |..|.:.|.|..:...|.|.|..|:.::|..|.|.|.||.|||.|...|.:.|.:.|..|.|.|.
Human   490 CDQCGKVFVSFSSLFAHLRTHTGEKPFKCYKCGKPFTSSACLRIHMRTHTEERLYQCKKCGKAFT 554

  Fly   267 RISHLMTHLSSNIHKRKEE 285
            :.|:|..||.::..::..|
Human   555 KCSYLTKHLRTHAGEKPYE 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 7/47 (15%)
zf-H2C2_2 186..211 CDD:290200 11/52 (21%)
UFD2 <256..>294 CDD:227443 9/30 (30%)
C2H2 Zn finger 258..280 CDD:275368 8/21 (38%)
ZNF560NP_689689.2 KRAB 13..69 CDD:214630
KRAB 13..50 CDD:279668
KRAB 110..161 CDD:214630
KRAB 110..149 CDD:279668
C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 323..342 CDD:275368
COG5048 344..754 CDD:227381 59/214 (28%)
C2H2 Zn finger 350..370 CDD:275368 4/9 (44%)
zf-H2C2_2 362..386 CDD:290200 8/23 (35%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 1/19 (5%)
C2H2 Zn finger 434..454 CDD:275368 5/19 (26%)
C2H2 Zn finger 490..510 CDD:275368 6/19 (32%)
zf-H2C2_2 502..527 CDD:290200 8/24 (33%)
C2H2 Zn finger 518..538 CDD:275368 10/19 (53%)
zf-H2C2_2 531..554 CDD:290200 8/22 (36%)
C2H2 Zn finger 546..566 CDD:275368 8/19 (42%)
zf-H2C2_2 558..582 CDD:290200 4/16 (25%)
C2H2 Zn finger 574..594 CDD:275368 59/214 (28%)
zf-H2C2_2 586..610 CDD:290200
zf-C2H2 600..622 CDD:278523
C2H2 Zn finger 602..622 CDD:275368
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 658..678 CDD:275368
C2H2 Zn finger 714..734 CDD:275368
zf-H2C2_2 726..751 CDD:290200
C2H2 Zn finger 742..762 CDD:275368
zf-H2C2_2 757..779 CDD:290200
C2H2 Zn finger 770..790 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.