DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF684

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_689586.3 Gene:ZNF684 / 127396 HGNCID:28418 Length:378 Species:Homo sapiens


Alignment Length:260 Identity:72/260 - (27%)
Similarity:111/260 - (42%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCIIAEKQNLERIECDSKDCS 85
            |.|..|::...|.| ||       :...|:.|    ..|.|.:...|..||.:..:...:..||.
Human   141 PPNLDLLKYNRSYT-VE-------NAYECSEC----GKAFKKKFHFIRHEKNHTRKKPFECNDCG 193

  Fly    86 TDPIIYEDIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRI 150
            ........:..:|.....:...:|.:.....|..|:.|.      ||: :..|..||.|..||:.
Human   194 KAYSRKAHLATHQKIHNGERPFVCNDCGKAFMHKAQLVV------HQR-LHTGEKPYECSQCGKT 251

  Fly   151 INNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGAR 215
            ....|:|.:|...||..|:|.|  ..|.::|.....|..|:|.||||:||.|:.|.:.|.::...
Human   252 FTWNSSFNQHVKSHTLEKSFEC--KECGKTFRYSSSLYKHSRFHTGEKPYQCIICGKAFGNTSVL 314

  Fly   216 QEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIH 280
            ..|.|.|..|:.|.|..|.|:|:....|.:|::.|...:.:.|..|.|.|.:.|:|:.|  ..||
Human   315 VTHQRIHTGEKPYSCIECGKAFIKKSHLLRHQITHTGEKPYECNRCGKAFSQKSNLIVH--QKIH 377

  Fly   281  280
            Human   378  377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 14/54 (26%)
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 9/25 (36%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
ZNF684NP_689586.3 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 161..181 CDD:275368 7/23 (30%)
zf-H2C2_2 173..198 CDD:290200 5/24 (21%)
COG5048 <185..345 CDD:227381 47/168 (28%)
zf-C2H2 187..209 CDD:278523 3/21 (14%)
C2H2 Zn finger 189..209 CDD:275368 3/19 (16%)
zf-H2C2_2 201..224 CDD:290200 2/22 (9%)
C2H2 Zn finger 217..237 CDD:275368 6/26 (23%)
zf-H2C2_2 230..253 CDD:290200 9/29 (31%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
C2H2 Zn finger 273..293 CDD:275368 6/21 (29%)
zf-H2C2_2 285..308 CDD:290200 11/22 (50%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 314..336 CDD:290200 8/21 (38%)
COG5048 325..>378 CDD:227381 17/55 (31%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 341..366 CDD:290200 7/24 (29%)
C2H2 Zn finger 357..377 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.