DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF554

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001096121.1 Gene:ZNF554 / 115196 HGNCID:26629 Length:538 Species:Homo sapiens


Alignment Length:167 Identity:58/167 - (34%)
Similarity:78/167 - (46%) Gaps:12/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SLNH------QKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKE 186
            ||||      ...|.....|:.|..||::.|.:.:..||...|||.|.:.|  ..|.|:|.....
Human   304 SLNHGMALTIHNKINTAEKPFECHQCGKVFNRRHSLSEHQRIHTGEKPYEC--QECGRAFTHSST 366

  Fly   187 LTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHV 251
            ||.|.|.||||:||.|..|.:.|:...:..:|.|.|..|:.|:|:.|.|||..|..|..||..|.
Human   367 LTRHLRTHTGEKPYGCGECGKAFNRISSLTQHQRIHTGEKPYKCEDCGKSFCQSSYLILHKRTHT 431

  Fly   252 DARNHYCYVCQKHFKRIS----HLMTHLSSNIHKRKE 284
            ..:.:.|..|.|.|...|    |..||...|.::.|:
Human   432 GEKPYECSECGKAFSDRSSLNQHERTHTGENPYECKQ 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 10/33 (30%)
C2H2 Zn finger 258..280 CDD:275368 9/25 (36%)
ZNF554NP_001096121.1 KRAB 44..84 CDD:307490
COG5048 <225..417 CDD:227381 41/114 (36%)
C2H2 Zn finger 276..291 CDD:275368
C2H2 Zn finger 293..318 CDD:275368 4/13 (31%)
zf-C2H2 324..346 CDD:306579 6/21 (29%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
COG5048 <350..532 CDD:227381 43/121 (36%)
C2H2 Zn finger 354..374 CDD:275368 8/21 (38%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
C2H2 Zn finger 410..430 CDD:275368 9/19 (47%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
C2H2 Zn finger 466..486 CDD:275368 1/3 (33%)
C2H2 Zn finger 494..514 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.