DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and ZNF460

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_006626.3 Gene:ZNF460 / 10794 HGNCID:21628 Length:562 Species:Homo sapiens


Alignment Length:210 Identity:67/210 - (31%)
Similarity:93/210 - (44%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DSKDCSTDPIIYEDIDDNQIESELDESI-------LCPEVKDLPMPSAEKVSAPTS--LNHQKSI 135
            ||....||.:|:|..:..:.|...:|:.       :.|.||....|...|....:.  |.|. .|
Human   154 DSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHH-II 217

  Fly   136 GGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPY 200
            ..|..||.|.:||:..|.:|:...|...|.|.|.|.|  ..|.|:|.....||.|.|:|:||:|:
Human   218 HTGEKPYKCLECGKDFNRRSHLTRHQRTHNGDKPFVC--SECGRTFNRGSHLTRHQRVHSGEKPF 280

  Fly   201 VCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHF 265
            ||..|.:.|:.......|::.|..::.:.|..|.|.|..|..|.:|.:||...|...|..|.|.|
Human   281 VCNECGKAFTYRSNFVLHNKSHNEKKPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAF 345

  Fly   266 KRISHLMTHLSSNIH 280
            ...|||..|  ..||
Human   346 NCRSHLKQH--ERIH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 12/24 (50%)
UFD2 <256..>294 CDD:227443 10/25 (40%)
C2H2 Zn finger 258..280 CDD:275368 8/21 (38%)
ZNF460NP_006626.3 KRAB 12..53 CDD:307490
C2H2 Zn finger 198..218 CDD:275368 4/20 (20%)
COG5048 222..552 CDD:227381 50/141 (35%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
C2H2 Zn finger 254..274 CDD:275368 8/21 (38%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
C2H2 Zn finger 310..330 CDD:275368 7/19 (37%)
C2H2 Zn finger 338..358 CDD:275368 8/21 (38%)
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 394..414 CDD:275368
C2H2 Zn finger 422..442 CDD:275368
C2H2 Zn finger 450..470 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.