Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009303622.2 | Gene: | LOC103911751 / 103911751 | -ID: | - | Length: | 257 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 67/267 - (25%) |
---|---|---|---|
Similarity: | 109/267 - (40%) | Gaps: | 67/267 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 CLDNL------------QAAIKFRQRCIIAEKQNLERIECDSKDCSTDPIIYEDIDDNQIESELD 104
Fly 105 ESI---LCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTG 166
Fly 167 IKNFHCVFLNCERSFATRKELTSHTRIHTGEQPY----------------------------VCV 203
Fly 204 YCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRI 268
Fly 269 SHLMTHL 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 9/35 (26%) |
C2H2 Zn finger | 144..164 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 172..194 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 186..211 | CDD:290200 | 13/52 (25%) | ||
UFD2 | <256..>294 | CDD:227443 | 6/20 (30%) | ||
C2H2 Zn finger | 258..280 | CDD:275368 | 6/18 (33%) | ||
LOC103911751 | XP_009303622.2 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |