DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and si:ch211-235i11.4

DIOPT Version :10

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001430205.1 Gene:si:ch211-235i11.4 / 103909096 ZFINID:ZDB-GENE-131126-23 Length:405 Species:Danio rerio


Alignment Length:140 Identity:52/140 - (37%)
Similarity:73/140 - (52%) Gaps:4/140 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYC 205
            ||.|.:||:.....||.:.|...||.:|...|  ..||::|||.:.|..|.||||||:||.|.:|
Zfish   235 PYSCSECGKSFTGMSNLRHHQKIHTAVKEHMC--FECEKTFATAQNLKLHQRIHTGEKPYKCSHC 297

  Fly   206 PRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISH 270
            .:||...|..:.|...|..|:.|:|..|...|.....|:.|:|||...:.:.|..|.|.|:.:.:
Zfish   298 NKRFRQFGGLKTHQMIHTGEKPYKCSHCNNQFSRLATLKLHEMIHTGEKPYKCSHCNKTFRDLGN 362

  Fly   271 LMTHLSSNIH 280
            :.||  ..||
Zfish   363 MKTH--ERIH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 5..76 CDD:462262
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 9/21 (43%)
UFD2 <256..>294 CDD:227443 8/25 (32%)
C2H2 Zn finger 258..280 CDD:275368 6/21 (29%)
si:ch211-235i11.4NP_001430205.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.