DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6813 and LOC101883087

DIOPT Version :9

Sequence 1:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_005174664.1 Gene:LOC101883087 / 101883087 -ID:- Length:318 Species:Danio rerio


Alignment Length:150 Identity:55/150 - (36%)
Similarity:77/150 - (51%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 HQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHT 195
            |||: ......:||.|||:........:.|.:.|||.:.:.|.:  ||:.|.....|..|.||||
Zfish   166 HQKT-HDEVRDHVCCDCGKSFKTALQLKRHQIVHTGERPYKCSY--CEKRFNQSGHLKVHERIHT 227

  Fly   196 GEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYV 260
            ||:||.|..|.:.|..:.....|.|.|..||.|:||.|.|.|.:|..|::|..:|:|.:.|.|.|
Zfish   228 GERPYHCTQCGKTFKCTNTFSNHLRVHSEERAYQCDQCGKDFTTSSNLKQHLKVHLDEKPHLCSV 292

  Fly   261 CQKHFKRISHLMTHLSSNIH 280
            |.|.|.|:::...|  ..||
Zfish   293 CGKGFSRLANCRKH--QKIH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 7/21 (33%)
zf-H2C2_2 186..211 CDD:290200 13/24 (54%)
UFD2 <256..>294 CDD:227443 9/24 (38%)
C2H2 Zn finger 258..280 CDD:275368 7/21 (33%)
LOC101883087XP_005174664.1 C2H2 Zn finger 66..86 CDD:275368
COG5048 <71..253 CDD:227381 30/89 (34%)
zf-H2C2_2 78..102 CDD:290200
C2H2 Zn finger 94..114 CDD:275368
C2H2 Zn finger 122..142 CDD:275368
zf-H2C2_2 134..159 CDD:290200
C2H2 Zn finger 150..170 CDD:275368 3/4 (75%)
ROS_MUCR <169..>194 CDD:303058 5/25 (20%)
C2H2 Zn finger 178..198 CDD:275368 5/19 (26%)
zf-H2C2_2 191..215 CDD:290200 8/25 (32%)
C2H2 Zn finger 206..226 CDD:275368 7/21 (33%)
zf-H2C2_2 218..243 CDD:290200 13/24 (54%)
C2H2 Zn finger 234..254 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..310 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.