| Sequence 1: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001106205.1 | Gene: | ZSCAN30 / 100101467 | HGNCID: | 33517 | Length: | 494 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 71/259 - (27%) |
|---|---|---|---|
| Similarity: | 104/259 - (40%) | Gaps: | 36/259 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 HLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCIIAEKQNLERIECDSKDCSTDPI 89
Fly 90 I-YEDIDDNQIESELDESILCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINN 153
Fly 154 KSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEH 218
Fly 219 HRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKR 282 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 8/50 (16%) |
| C2H2 Zn finger | 144..164 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 172..194 | CDD:275368 | 5/21 (24%) | ||
| zf-H2C2_2 | 186..211 | CDD:290200 | 10/24 (42%) | ||
| UFD2 | <256..>294 | CDD:227443 | 10/27 (37%) | ||
| C2H2 Zn finger | 258..280 | CDD:275368 | 8/21 (38%) | ||
| ZSCAN30 | NP_001106205.1 | SCAN | 44..154 | CDD:128708 | |
| SCAN | 44..122 | CDD:280241 | |||
| COG5048 | 281..>360 | CDD:227381 | 16/98 (16%) | ||
| zf-C2H2 | 301..323 | CDD:278523 | 4/21 (19%) | ||
| C2H2 Zn finger | 303..323 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 316..339 | CDD:290200 | 4/35 (11%) | ||
| COG5048 | <328..479 | CDD:227381 | 51/159 (32%) | ||
| C2H2 Zn finger | 331..351 | CDD:275368 | 4/26 (15%) | ||
| zf-H2C2_2 | 343..366 | CDD:290200 | 8/22 (36%) | ||
| C2H2 Zn finger | 359..379 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 371..396 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 387..407 | CDD:275368 | 5/21 (24%) | ||
| zf-H2C2_2 | 399..424 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 415..435 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 428..452 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 443..463 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 455..480 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 471..491 | CDD:275368 | 8/21 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||