DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14711 and ZNF561

DIOPT Version :9

Sequence 1:	NP_650094.1	Gene:	CG14711 / 41395	FlyBaseID:	FBgn0037922	Length:	377	Species:	Drosophila melanogaster
Sequence 2:	XP_024307548.1	Gene:	ZNF561 / 93134	HGNCID:	28684	Length:	502	Species:	Homo sapiens

Alignment Length:	182	Identity:	66/182 - (36%)
Similarity:	101/182 - (55%)	Gaps:	28/182 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   175 CRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRA 239
            |.||..|.|::|:            |.|:.:..:|                ..|:.||..:::.:
Human   330 CGKAFTRSTQLTE------------HVRTHTGIKP----------------YECKECGQAFAQYS 366

  Fly   240 ALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTH 304
            .|:||:|.|..:||::|:.|.|:|...:.|.:|.|:||||||:.|..|.::|...|...:|.:||
Human   367 GLSIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRRSKHLKTH 431

  Fly   305 TNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQH 356
            :.|:||.|..|||||.||:.|..|:.||||||||:|:.|.|.|:...:|.:|
Human   432 SGEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCKECGKAFAVSSRLSRH 483

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14711	NP_650094.1	zf-AD	6..81	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	7/19 (37%)
		zf-H2C2_2	240..264	CDD:290200	10/23 (43%)
		COG5048	249..>362	CDD:227381	49/108 (45%)
		C2H2 Zn finger	256..276	CDD:275368	7/19 (37%)
		zf-H2C2_2	268..292	CDD:290200	11/23 (48%)
		C2H2 Zn finger	284..304	CDD:275368	5/19 (26%)
		zf-H2C2_2	299..321	CDD:290200	12/21 (57%)
		C2H2 Zn finger	312..332	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	14/23 (61%)
		C2H2 Zn finger	340..362	CDD:275368	6/17 (35%)
ZNF561	XP_024307548.1	KRAB	56..96	CDD:307490
		C2H2 Zn finger	190..207	CDD:275370
		C2H2 Zn finger	215..235	CDD:275368
		C2H2 Zn finger	243..263	CDD:275368
		COG5048	<287..483	CDD:227381	65/180 (36%)
		C2H2 Zn finger	299..319	CDD:275368
		C2H2 Zn finger	327..347	CDD:275368	8/28 (29%)
		C2H2 Zn finger	355..375	CDD:275368	7/19 (37%)
		C2H2 Zn finger	383..403	CDD:275368	7/19 (37%)
		C2H2 Zn finger	411..431	CDD:275368	5/19 (26%)
		C2H2 Zn finger	439..459	CDD:275368	10/19 (53%)
		C2H2 Zn finger	467..487	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S6356
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.860