DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CMR3

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:59/306 - (19%)
Similarity:114/306 - (37%) Gaps:90/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AMAPLFDDN-----DAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHKFRELCQESE 78
            ::.|.|::|     |::.:...:::.:  |:.:||:.|    ..|:.:....::.::.....||:
Yeast    79 SLLPNFENNTPPNVDSRVQFPPQQVYQ--SMNVVPIVN----EIYTPISMNATSDQYPIYYTESQ 137

  Fly    79 RTFATNVVKAEMKSEPTDEVPHVVAD-------NIEYIYESANDFIDGVEDDIGMENIMEEPLED 136
            :..            |..:.||:.:.       .:..:|:....:      |.....|..||...
Yeast   138 QPI------------PHSQSPHLTSSAPLMMPVMVPTVYKPLTPY------DKEPITIASEPNFT 184

  Fly   137 GVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHP 201
            .:...|.......:..|.       |.|....|..:...::|...:|      :..| ||.....
Yeast   185 AISMASHPNAALELCHDR-------PKSVPPGYGVLPTMQEASNGRT------KSEP-GAVLNGS 235

  Fly   202 RSFSEERPPVQASFKSSPEVSSTNI--MCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFA 264
            .:||:        :|:...:|||.:  .|.:||                        :|||:   
Yeast   236 ATFSD--------WKTDTRISSTKLRKQCPVCG------------------------KICSR--- 265

  Fly   265 GPSELNRHIRVHTGEKPFLCKY--CNRSFADRSSNIRHERTHTNER 308
             ||.|..|..:|||:.||.|.:  |.:||..:|:.:||.::|..:|
Yeast   266 -PSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 11/66 (17%)
C2H2 Zn finger 228..248 CDD:275368 3/19 (16%)
zf-H2C2_2 240..264 CDD:290200 3/23 (13%)
COG5048 249..>362 CDD:227381 21/62 (34%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 10/25 (40%)
C2H2 Zn finger 284..304 CDD:275368 7/21 (33%)
zf-H2C2_2 299..321 CDD:290200 4/10 (40%)
C2H2 Zn finger 312..332 CDD:275368
zf-H2C2_2 325..349 CDD:290200
C2H2 Zn finger 340..362 CDD:275368
CMR3NP_015338.1 COG5048 17..316 CDD:227381 59/306 (19%)
C2H2 Zn finger 256..276 CDD:275370 10/47 (21%)
C2H2 Zn finger 284..306 CDD:275370 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.