DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZNF559

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001189335.1 Gene:ZNF559 / 84527 HGNCID:28197 Length:602 Species:Homo sapiens


Alignment Length:403 Identity:105/403 - (26%)
Similarity:160/403 - (39%) Gaps:109/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVE--RLTSAHKFRELCQESERTF-ATN 84
            |||.|  ||.:.:.:                    :||::  |.|...|....|.:.|:.| ..:
Human   154 LFDFN--QCEKALSE--------------------HSCLKTHRRTYFRKKTCECNQCEKAFRKPS 196

  Fly    85 VVKAEMKSEPTDEVP-------------HVV----ADNIEYIYESANDFIDGVEDDIGMENIMEE 132
            :.....|::..:|:|             |:|    :.|:..:.:..              :..|:
Human   197 IFTLHKKTDIGEELPNCNQCETAFSQHLHLVCKKTSQNLHLVCKKT--------------HTQEK 247

  Fly   133 P-----LEDGVGETS------------QAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKV 180
            |     .|.|:..:|            :.|.....|:.......|..:....|.:....|:..  
Human   248 PYKCSDCEKGLPSSSHLRECVRIYGGERPYTHKEYVETFSHSTALFVHMQTQDGEKFYECKAC-- 310

  Fly   181 RKTRMTKRGRGRPRGASS-------GHPRSFSEERPPVQASFKSSPEVS--------STNIMCEI 230
                      |:|...||       .|.|....|......:|..||:::        ..:.:|..
Human   311 ----------GKPFTESSYLTQHLRTHSRVLPIEHKKFGKAFAFSPDLAKHIRLRTRGKHYVCNE 365

  Fly   231 CGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRS 295
            ||..::..:.||||:|.|..|||::|..|.|:|...|.|.:|.|.||||||:.||.|.::||:.|
Human   366 CGKEFTCFSKLNIHIRVHTGEKPYECNKCGKAFTDSSGLIKHRRTHTGEKPYECKECGKAFANSS 430

  Fly   296 SNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTM 360
            ....|.||||.|:|:.|..|||||..|:..|:||.||.|.||:.|:.|.|.|.|...|.:||.: 
Human   431 HLTVHMRTHTGEKPYQCKECGKAFINSSSFKSHMQTHPGVKPYDCQQCGKAFIRSSFLIRHLRS- 494

  Fly   361 THQQTVIHHKNER 373
                    |..||
Human   495 --------HSAER 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 13/59 (22%)
C2H2 Zn finger 228..248 CDD:275368 8/19 (42%)
zf-H2C2_2 240..264 CDD:290200 12/23 (52%)
COG5048 249..>362 CDD:227381 53/112 (47%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-H2C2_2 268..292 CDD:290200 12/23 (52%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 13/21 (62%)
C2H2 Zn finger 312..332 CDD:275368 10/19 (53%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 8/21 (38%)
ZNF559NP_001189335.1 KRAB 78..>118 CDD:214630
KRAB 78..117 CDD:279668
C2H2 Zn finger 158..177 CDD:275368 6/40 (15%)
C2H2 Zn finger 185..240 CDD:275368 9/54 (17%)
COG5048 212..601 CDD:227381 88/323 (27%)
C2H2 Zn finger 213..243 CDD:275368 3/43 (7%)
C2H2 Zn finger 251..299 CDD:275368 6/47 (13%)
C2H2 Zn finger 307..327 CDD:275368 5/31 (16%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-H2C2_2 376..399 CDD:290200 12/22 (55%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
zf-H2C2_2 404..428 CDD:290200 13/23 (57%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
zf-H2C2_2 431..454 CDD:290200 11/22 (50%)
zf-C2H2 445..467 CDD:278523 10/21 (48%)
C2H2 Zn finger 447..467 CDD:275368 10/19 (53%)
C2H2 Zn finger 475..495 CDD:275368 8/28 (29%)
zf-H2C2_2 488..512 CDD:290200 6/21 (29%)
C2H2 Zn finger 503..523 CDD:275368
zf-H2C2_2 515..539 CDD:290200
C2H2 Zn finger 531..551 CDD:275368
zf-H2C2_2 544..568 CDD:290200
C2H2 Zn finger 559..579 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.