DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and WIP3

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:213 Identity:50/213 - (23%)
Similarity:76/213 - (35%) Gaps:63/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RGAS-SGHPRSFSEERPPV--------------QASFKSSPEVSSTNIMCEICGNIYSKRAALNI 243
            ||:| .|...:|..::.|:              :...|...|:..:::  |:||    ||..:..
plant   111 RGSSEDGSDITFDHQKKPIKREIIEDGVVMMKKRRKMKFDEEIIDSDV--EVCG----KRFWIPS 169

  Fly   244 HMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGE------------KP-----FLCKYCNRSF 291
            ..:.|:....|.|.||||:|...:.:..|:..|..|            :|     ..|..|....
plant   170 PAQIHVGPMQFACSICSKTFNRYNNMQMHMWGHGSEFRKGADSLKGTIQPAAILRLPCYCCAEGC 234

  Fly   292 ADRSSNIRHER-----------TH----TNERPFTCSTCGKAFSYSNVLKNHMLTHTGE--KPFL 339
               .:||.|.|           ||    ...:||:|..||||.:    :|....||...  |.:.
plant   235 ---KNNINHPRSKPLKDFRTLQTHYKRKHGSKPFSCGKCGKALA----VKGDWRTHEKNCGKLWY 292

  Fly   340 CRVCNKTFSRKHQLDQHL 357
            | .|...|..|..|..|:
plant   293 C-TCGSDFKHKRSLKDHI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 7/23 (30%)
COG5048 249..>362 CDD:227381 36/143 (25%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 6/40 (15%)
C2H2 Zn finger 284..304 CDD:275368 6/30 (20%)
zf-H2C2_2 299..321 CDD:290200 11/36 (31%)
C2H2 Zn finger 312..332 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 7/25 (28%)
C2H2 Zn finger 340..362 CDD:275368 6/18 (33%)
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.