DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14711 and ZNF124

DIOPT Version :9

Sequence 1:	NP_650094.1	Gene:	CG14711 / 41395	FlyBaseID:	FBgn0037922	Length:	377	Species:	Drosophila melanogaster
Sequence 2:	NP_001284497.1	Gene:	ZNF124 / 7678	HGNCID:	12907	Length:	351	Species:	Homo sapiens

Alignment Length:	131	Identity:	64/131 - (48%)
Similarity:	84/131 - (64%)	Gaps:	2/131 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   228 CEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFA 292
            |.||..:::..::..||.|.|..|||::|..|.|:......||||.|:|||||.:.||.|.::|:
Human   124 CTICEKVFNIPSSFQIHQRNHTGEKPYECMECGKALGFSRSLNRHKRIHTGEKRYECKQCGKAFS 188

  Fly   293 DRSSNIR-HERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQH 356
             |||::| ||||||.|:|:.|..|||||.|||.|..|..|||||||::|..|.|.||....|..|
Human   189 -RSSHLRDHERTHTGEKPYECKHCGKAFRYSNCLHYHERTHTGEKPYVCMECGKAFSCLSSLQGH 252

  Fly   357 L 357
            :
Human   253 I 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14711	NP_650094.1	zf-AD	6..81	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	6/19 (32%)
		zf-H2C2_2	240..264	CDD:290200	10/23 (43%)
		COG5048	249..>362	CDD:227381	57/110 (52%)
		C2H2 Zn finger	256..276	CDD:275368	8/19 (42%)
		zf-H2C2_2	268..292	CDD:290200	13/23 (57%)
		C2H2 Zn finger	284..304	CDD:275368	11/20 (55%)
		zf-H2C2_2	299..321	CDD:290200	15/22 (68%)
		C2H2 Zn finger	312..332	CDD:275368	11/19 (58%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	340..362	CDD:275368	7/18 (39%)
ZNF124	NP_001284497.1	KRAB	12..53	CDD:307490
		C2H2 Zn finger	96..116	CDD:275368
		C2H2 Zn finger	124..144	CDD:275368	6/19 (32%)
		C2H2 Zn finger	152..172	CDD:275368	8/19 (42%)
		COG5048	<176..338	CDD:227381	42/79 (53%)
		C2H2 Zn finger	180..200	CDD:275368	11/20 (55%)
		C2H2 Zn finger	208..228	CDD:275368	11/19 (58%)
		C2H2 Zn finger	236..256	CDD:275368	7/18 (39%)
		C2H2 Zn finger	264..284	CDD:275368
		C2H2 Zn finger	292..312	CDD:275368
		C2H2 Zn finger	320..340	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910