Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008894.2 | Gene: | ZNF22 / 7570 | HGNCID: | 13012 | Length: | 224 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 74/201 - (36%) |
---|---|---|---|
Similarity: | 97/201 - (48%) | Gaps: | 22/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 RKAKVRKTRMTKRGRGRPR---GASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSK 237
Fly 238 RAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHER 302
Fly 303 THTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVI 367
Fly 368 HHKNER 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 9/23 (39%) | ||
COG5048 | 249..>362 | CDD:227381 | 52/112 (46%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 8/21 (38%) | ||
ZNF22 | NP_008894.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | 7/21 (33%) | |
COG5048 | <41..194 | CDD:227381 | 66/172 (38%) | ||
C2H2 Zn finger | 57..77 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 85..105 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 113..133 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 141..161 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 169..189 | CDD:275368 | 8/28 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |