DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZNF22

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_008894.2 Gene:ZNF22 / 7570 HGNCID:13012 Length:224 Species:Homo sapiens


Alignment Length:201 Identity:74/201 - (36%)
Similarity:97/201 - (48%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 RKAKVRKTRMTKRGRGRPR---GASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSK 237
            |.:...|....||..||.|   |.:.....|||.    ::.|....|      ..|..|...:|:
Human    12 RSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSR----LRRSLDDKP------YKCTECEKSFSQ 66

  Fly   238 RAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHER 302
            .:.|..|.:.|..:|..||..|.|||...|.|.:|.|:||||||:.|..|..||...|:.|:|:|
Human    67 SSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQR 131

  Fly   303 THTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVI 367
            .||.|:|:.|..||:.||.|:.|..|..|||||||:.|..|.|.||:...|.||:..        
Human   132 IHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKV-------- 188

  Fly   368 HHKNER 373
             ||.|:
Human   189 -HKEEK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 9/23 (39%)
COG5048 249..>362 CDD:227381 52/112 (46%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
zf-H2C2_2 268..292 CDD:290200 12/23 (52%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 8/21 (38%)
ZNF22NP_008894.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 7/21 (33%)
COG5048 <41..194 CDD:227381 66/172 (38%)
C2H2 Zn finger 57..77 CDD:275368 5/19 (26%)
C2H2 Zn finger 85..105 CDD:275368 9/19 (47%)
C2H2 Zn finger 113..133 CDD:275368 8/19 (42%)
C2H2 Zn finger 141..161 CDD:275368 8/19 (42%)
C2H2 Zn finger 169..189 CDD:275368 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.