DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZNF3

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001305065.1 Gene:ZNF3 / 7551 HGNCID:13089 Length:453 Species:Homo sapiens


Alignment Length:372 Identity:104/372 - (27%)
Similarity:157/372 - (42%) Gaps:97/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPSMLC--------------------YSCVERLTSAHKFRELCQESERTF---ATNVVKAEMKS- 92
            :||.:|                    .:|...|     |:||.     ||   |...::.|.|. 
Human    21 LPSQMCIFHPILSDFFGAAIHIPHPEIACQHVL-----FQELV-----TFEDVAVYFIRKEWKRL 75

  Fly    93 EPT--DEVPHVVADNIEYIY----ESANDFIDGVEDDIGMENIM----EEPLEDGVGETSQAYET 147
            ||.  |....|:.:|...::    |:..:....:.:|.....::    ::.:..|: :..:|||.
Human    76 EPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGL-KFKEAYER 139

  Fly   148 STVVDDLDEDDLLVP--NSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPP 210
                    |..|..|  ||      |.||..:......::|...:..|||           ||..
Human   140 --------EVSLKRPLGNS------PGERLNRKMPDFGQVTVEEKLTPRG-----------ERSE 179

  Fly   211 VQASFKSSPEVSSTNI------------MCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSF 263
            ....|.:|..|:|..|            .|:.|...:::.:.|..|.|.|..|||::|..|.|:|
Human   180 KYNDFGNSFTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAF 244

  Fly   264 AGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNH 328
            :..|.|.:|.|:||||||:.|..|.::|:..|:.|.|.|.||.|:|:.|:.|||.||:|:.|.:|
Human   245 SQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLTHH 309

  Fly   329 MLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHHKNERTG 375
            ...||||||:.|..|.|.|||             ..|:|||:...||
Human   310 QRIHTGEKPYACNECGKAFSR-------------SSTLIHHQRIHTG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 8/48 (17%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 49/112 (44%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-H2C2_2 268..292 CDD:290200 11/23 (48%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 11/21 (52%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
ZNF3NP_001305065.1 KRAB 57..98 CDD:366587 11/45 (24%)
COG5048 <182..360 CDD:227381 66/175 (38%)
C2H2 Zn finger 185..201 CDD:275368 4/15 (27%)
C2H2 Zn finger 209..229 CDD:275368 5/19 (26%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 265..285 CDD:275368 7/19 (37%)
C2H2 Zn finger 293..313 CDD:275368 9/19 (47%)
C2H2 Zn finger 321..341 CDD:275368 10/32 (31%)
C2H2 Zn finger 349..369 CDD:275368
zf-H2C2_2 361..386 CDD:372612
C2H2 Zn finger 377..397 CDD:275368
zf-H2C2_2 390..414 CDD:372612
C2H2 Zn finger 405..425 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.