DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14711 and Rreb1

DIOPT Version :9

Sequence 1:	NP_650094.1	Gene:	CG14711 / 41395	FlyBaseID:	FBgn0037922	Length:	377	Species:	Drosophila melanogaster
Sequence 2:	NP_001171340.1	Gene:	Rreb1 / 68750	MGIID:	2443664	Length:	1754	Species:	Mus musculus

Alignment Length:	184	Identity:	56/184 - (30%)
Similarity:	77/184 - (41%)	Gaps:	40/184 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   214 SFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTG 278
            |.|.:|.:......|..|..:::....|..|:|.|:...|::|.||....|..:.|.||||.|:|
Mouse   629 SGKKTPAMRKVLYPCRFCNQVFAFSGVLRAHVRSHLGISPYQCNICDYIAADKAALIRHIRTHSG 693

  Fly   279 EKPFLCKYCNRSFA-------------------DRSSNIRHERTHTNE------RPFT-CSTCGK 317
            |:|::||.|:..|.                   |...||.:..:.|.|      .|.| |..||:
Mouse   694 ERPYICKICHYPFTVKANCERHLRKKHLKATRKDIEKNIEYVSSPTAELVDAFCAPETVCRLCGE 758

  Fly   318 AFSYSNVLKNHMLT---------HTGEKPFLCRVCNKTFSRK-----HQLDQHL 357
            ...:...|:.||.|         |.|.|||.|:.||..|..|     |.|.|||
Mouse   759 DLKHYRALRIHMRTHCSRGLGGCHKGRKPFECKECNAPFVAKRNCIHHILKQHL 812

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14711	NP_650094.1	zf-AD	6..81	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	5/19 (26%)
		zf-H2C2_2	240..264	CDD:290200	8/23 (35%)
		COG5048	249..>362	CDD:227381	47/149 (32%)
		C2H2 Zn finger	256..276	CDD:275368	9/19 (47%)
		zf-H2C2_2	268..292	CDD:290200	12/23 (52%)
		C2H2 Zn finger	284..304	CDD:275368	7/38 (18%)
		zf-H2C2_2	299..321	CDD:290200	7/28 (25%)
		C2H2 Zn finger	312..332	CDD:275368	7/28 (25%)
		zf-H2C2_2	325..349	CDD:290200	13/32 (41%)
		C2H2 Zn finger	340..362	CDD:275368	10/23 (43%)
Rreb1	NP_001171340.1	COG5048	<64..244	CDD:227381
		C2H2 Zn finger	68..88	CDD:275368
		C2H2 Zn finger	99..119	CDD:275368
		zf-H2C2_2	111..136	CDD:372612
		C2H2 Zn finger	127..147	CDD:275368
		C2H2 Zn finger	209..228	CDD:275368
		C2H2 Zn finger	235..251	CDD:275368
		C2H2 Zn finger	316..336	CDD:275368
		DEC-1_N	381..>672	CDD:368028	10/42 (24%)
		C2H2 Zn finger	643..663	CDD:275368	5/19 (26%)
		zf-H2C2_5	669..693	CDD:372805	10/23 (43%)
		C2H2 Zn finger	671..691	CDD:275368	9/19 (47%)
		C2H2 Zn finger	699..717	CDD:275368	4/17 (24%)
		C2H2 Zn finger	753..773	CDD:275368	6/19 (32%)
		C2H2 Zn finger	790..813	CDD:275368	10/23 (43%)
		C2H2 Zn finger	1253..1273	CDD:275368
		ZnF_C2H2	1253..1273	CDD:197676
		zf-H2C2_2	1265..1290	CDD:372612
		C2H2 Zn finger	1281..1302	CDD:275368
		zf-C2H2_6	1575..1596	CDD:372808
		C2H2 Zn finger	1576..1596	CDD:275368
		zf-H2C2_2	1588..1612	CDD:372612
		zf-C2H2	1602..1624	CDD:333835
		C2H2 Zn finger	1604..1624	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S6356
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950