DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and ZFP69B

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_005271193.1 Gene:ZFP69B / 65243 HGNCID:28053 Length:535 Species:Homo sapiens


Alignment Length:466 Identity:127/466 - (27%)
Similarity:191/466 - (40%) Gaps:119/466 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RICLTEDINS--EAMAPLFDDNDAQCRELVRKIEEVGSI-----KLVPLQNIPSMLCYSCVERLT 65
            |:.|.||:..  :|.|.|..|.|....|.:.....:||:     :|:..:::..........:|.
Human    28 RVALWEDVTKMFKAEALLSQDADETQGESLESRVTLGSLTAESQELLTFKDVSVDFTQEEWGQLA 92

  Fly    66 SAHK--FREL-------------CQESERTFATNVVKAE---MKSEPTDEVPHVVADNIEYIYES 112
            .||:  :||:             ||.|:....:.:.|.|   :.......||.....:.....||
Human    93 PAHRNLYREVMLENYGNLVSVAGCQLSKPGVISQLEKGEEPWLMERDISGVPSSDLKSKTKTKES 157

  Fly   113 ANDFIDGVEDDIGME----NIMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIE 173
            |      :::||..|    .:|.|....|    |..|.|...:...        |..:|. |..:
Human   158 A------LQNDISWEELHCGLMMERFTKG----SSMYSTLGRISKC--------NKLESQ-QENQ 203

  Fly   174 RCRKAKV----RKTRMTKRGR--------------------GRPR---------GASS------- 198
            |..|.::    :||...:||:                    |.||         |..|       
Human   204 RMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLV 268

  Fly   199 GHPRSFSE----ERPPVQASFKSSPEVSSTNIM----------CEICGNIYSKRAALNIHMRRHM 249
            .|.||:::    |....:..||..  :..|..|          |:.||..:|:.::|..|.|.|.
Human   269 NHSRSYTKMKTFECNICEKIFKQL--IHLTEHMRIHTGEKPFRCKECGKAFSQSSSLIPHQRIHT 331

  Fly   250 AEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCST 314
            .|||::|:.|.|:|..||.|.:|:|:||||||:.|:.|.::|:.....|:|.|||..|:||||..
Human   332 GEKPYECKECGKTFRHPSSLTQHVRIHTGEKPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKD 396

  Fly   315 CGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTV------------I 367
            |||||.....|:.|.:.|||.||::|.||:||||....|.||..|.|.::..            |
Human   397 CGKAFFQIRHLRQHEIIHTGVKPYICNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRI 461

  Fly   368 H---HKNERTG 375
            |   |:...||
Human   462 HLSIHQRVHTG 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 21/94 (22%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 54/112 (48%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
zf-H2C2_2 268..292 CDD:290200 11/23 (48%)
C2H2 Zn finger 284..304 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 14/21 (67%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 11/21 (52%)
ZFP69BXP_005271193.1 SCAN <2..40 CDD:383046 4/11 (36%)
KRAB 74..134 CDD:214630 10/59 (17%)
COG5048 <194..430 CDD:227381 78/238 (33%)
C2H2 Zn finger 258..274 CDD:275368 4/15 (27%)
C2H2 Zn finger 282..302 CDD:275368 4/21 (19%)
C2H2 Zn finger 310..330 CDD:275368 7/19 (37%)
C2H2 Zn finger 338..358 CDD:275368 9/19 (47%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
C2H2 Zn finger 394..414 CDD:275368 8/19 (42%)
C2H2 Zn finger 422..442 CDD:275368 10/19 (53%)
zf-H2C2_2 434..459 CDD:372612 5/24 (21%)
C2H2 Zn finger 450..470 CDD:275368 3/19 (16%)
zf-H2C2_2 462..487 CDD:372612 4/11 (36%)
C2H2 Zn finger 478..498 CDD:275368
zf-H2C2_2 490..515 CDD:372612
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.