DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and znf16l

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_699131.3 Gene:znf16l / 570544 ZFINID:ZDB-GENE-160728-135 Length:522 Species:Danio rerio


Alignment Length:389 Identity:92/389 - (23%)
Similarity:141/389 - (36%) Gaps:80/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IC--LTEDINSEAMAPLFDDNDAQC----RELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSA 67
            ||  |.:|.|....|.:..|:..|.    |::..:.:..||:.|.| .:.|:.         |.|
Zfish   147 ICDYLMKDKNQRGAAEVESDHSNQAFGSERDVRTEAQPHGSLSLWP-DSGPAD---------TDA 201

  Fly    68 HK--FRELCQESERTF------ATNVVKAEMKSE---PTDEVPHVVADNIEYIYESANDFIDGVE 121
            ..  |..|...|:|.:      ...:..||.|.:   ..::||.:..::.....|.....:..|.
Zfish   202 ETDIFSMLPSASKRMYDYEWMTGVELNSAEFKGDSETKCEDVPPMDEEDENEDSEEGRGSLRSVS 266

  Fly   122 DDIGME------NIMEEPLEDGVG--ETSQAYETSTVV----------DDLDEDDLLVPNSTDSD 168
            |...::      .....|.||.:.  |..|.:.:.|.:          ....|:.:.:.:..:|.
Zfish   267 DHFPLDTQGSPGEDRSSPAEDSMDRMEPGQQFTSHTFICPFCGTLCPDSSFLEEHIKLMHHGESL 331

  Fly   169 YQPIERCRKAKVRKTRMTKRGRGRPRGASSGH--PRSFSEERPPVQASFKSSPEVSSTNIMCEIC 231
            .|              .|..|........||.  |.|.......|:..::           |..|
Zfish   332 LQ--------------STSAGSSSQAEGDSGEAGPASRGAREKKVEGGYE-----------CGDC 371

  Fly   232 GNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTG-EKPFLCKYCNRSFADRS 295
            |..::....|..|.|.|..||||.|..|.:.|...:.|..|...|:| :.||.|..|.:.|...|
Zfish   372 GRHFNYLGNLRQHQRIHTGEKPFVCPECGERFRHTARLKSHRLSHSGAQSPFPCPQCGKGFPVLS 436

  Fly   296 SNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGT 359
            ...||:|.||.|.|:.|..||:.|.....|..||..|:|..|:.|..|.::|       :||||
Zfish   437 GLKRHQRVHTGESPYACPQCGRRFKELGNLYTHMRIHSGATPYTCYQCGRSF-------RHLGT 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 20/79 (25%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 41/112 (37%)
C2H2 Zn finger 256..276 CDD:275368 5/19 (26%)
zf-H2C2_2 268..292 CDD:290200 8/24 (33%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 11/21 (52%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 340..362 CDD:275368 7/20 (35%)
znf16lXP_699131.3 C2H2 Zn finger 305..326 CDD:275368 1/20 (5%)
zf-C2H2 366..388 CDD:278523 6/32 (19%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
zf-H2C2_2 380..405 CDD:290200 11/24 (46%)
C2H2 Zn finger 396..445 CDD:275368 16/48 (33%)
COG5048 409..>481 CDD:227381 27/71 (38%)
zf-C2H2 423..445 CDD:278523 8/21 (38%)
zf-H2C2_2 438..461 CDD:290200 10/22 (45%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-H2C2_2 465..490 CDD:290200 9/31 (29%)
C2H2 Zn finger 481..498 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.