| Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001135777.1 | Gene: | ZNF771 / 51333 | HGNCID: | 29653 | Length: | 317 | Species: | Homo sapiens |
| Alignment Length: | 264 | Identity: | 83/264 - (31%) |
|---|---|---|---|
| Similarity: | 121/264 - (45%) | Gaps: | 38/264 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 121 EDDIGMENIMEEPLEDGVGETSQAYETSTVVDDLDEDDL----LVPNSTDSDYQPIERCRKAKVR 181
Fly 182 KTRMTKRGR----GRPRG------------ASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEI 230
Fly 231 CGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRS 295
Fly 296 SNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTM 360
Fly 361 THQQ 364 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
| C2H2 Zn finger | 228..248 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 240..264 | CDD:290200 | 10/23 (43%) | ||
| COG5048 | 249..>362 | CDD:227381 | 51/112 (46%) | ||
| C2H2 Zn finger | 256..276 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 268..292 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 284..304 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 299..321 | CDD:290200 | 13/21 (62%) | ||
| C2H2 Zn finger | 312..332 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 340..362 | CDD:275368 | 7/21 (33%) | ||
| ZNF771 | NP_001135777.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..63 | 9/52 (17%) | |
| COG5048 | <62..221 | CDD:227381 | 59/174 (34%) | ||
| C2H2 Zn finger | 65..85 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 93..113 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 121..141 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 149..169 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 177..197 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 205..225 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 217..242 | CDD:404364 | 12/24 (50%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 245..269 | CDD:404364 | 4/13 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 137 | 1.000 | Inparanoid score | I4545 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||