DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG1792

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:395 Identity:106/395 - (26%)
Similarity:161/395 - (40%) Gaps:100/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIC-----------LTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLV--PLQNIPSMLCY 58
            ||.|           |.|:.||               .::.:||.:..:.|:  |...:|..:|.
  Fly     6 CRTCGLFIFCSTPSNLFEEPNS---------------VMLHQIEVLTGLFLLGGPGNELPPFICS 55

  Fly    59 SCVERLTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDD 123
            .|...|.:|..|||....:::|.              .|.|::  .|.|.|    ..|..|||.:
  Fly    56 PCELDLQTAIAFRERVIRTQKTL--------------QESPNL--GNAELI----ESFAVGVEKE 100

  Fly   124 IGMENIMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKR 188
            |   ...||..|            ..|:|.|.|:.||  ..|:..|:..|:..:.:|:.....|:
  Fly   101 I---QYAEEVTE------------IEVIDLLPEEHLL--EETEEPYEICEQNEQPQVKVPAQEKK 148

  Fly   189 GRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSST----------------------NIMCEIC 231
            .|           || ::..|.|..|.|.:....:|                      :.:||.|
  Fly   149 LR-----------RS-TKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQC 201

  Fly   232 GNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSS 296
            |..::..:...:|:.||...|.|.|:.||:.|...:.|.||..:|.|...|.|:||..::::.|.
  Fly   202 GRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEATYSNASG 266

  Fly   297 NIRHER-THTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTM 360
            .|:||| .|||.:||||..|.|:|:.|..|:.|||:|||.:.|.|..|..:|.|:..|..|..:.
  Fly   267 RIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSK 331

  Fly   361 THQQT 365
            .|..|
  Fly   332 GHAHT 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 19/86 (22%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 8/23 (35%)
COG5048 249..>362 CDD:227381 45/113 (40%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 9/23 (39%)
C2H2 Zn finger 284..304 CDD:275368 8/20 (40%)
zf-H2C2_2 299..321 CDD:290200 13/22 (59%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 20/102 (20%)
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
C2H2 Zn finger 226..243 CDD:275368 6/16 (38%)
C2H2 Zn finger 254..275 CDD:275368 8/20 (40%)
zf-C2H2 281..303 CDD:278523 11/21 (52%)
C2H2 Zn finger 283..303 CDD:275368 9/19 (47%)
zf-H2C2_2 296..320 CDD:290200 11/23 (48%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.