Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524403.1 | Gene: | sqz / 42300 | FlyBaseID: | FBgn0010768 | Length: | 535 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 60/203 - (29%) |
---|---|---|---|
Similarity: | 96/203 - (47%) | Gaps: | 29/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 PRSFSEER------PPVQ--------ASFKSSPEVSSTN--------IMCEICGNIYSKRAALNI 243
Fly 244 HMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKY--CNRSFADRSSNIRHERTHTN 306
Fly 307 ERPFTCSTCGKAFSYSNVLKNHMLTHTGE---KPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIH 368
Fly 369 HKNERTGR 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
C2H2 Zn finger | 228..248 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 240..264 | CDD:290200 | 10/23 (43%) | ||
COG5048 | 249..>362 | CDD:227381 | 41/117 (35%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 268..292 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 284..304 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 312..332 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 7/26 (27%) | ||
C2H2 Zn finger | 340..362 | CDD:275368 | 6/21 (29%) | ||
sqz | NP_524403.1 | C2H2 Zn finger | 160..180 | CDD:275368 | 5/19 (26%) |
zf-H2C2_2 | 172..197 | CDD:290200 | 11/24 (46%) | ||
zf-C2H2 | 186..208 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 188..208 | CDD:275368 | 10/19 (53%) | ||
zf-C2H2_8 | 191..271 | CDD:292531 | 29/79 (37%) | ||
zf-H2C2_2 | 200..227 | CDD:290200 | 12/26 (46%) | ||
C2H2 Zn finger | 216..238 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 277..297 | CDD:275368 | 6/21 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24381 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |