DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG6813

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:373 Identity:100/373 - (26%)
Similarity:142/373 - (38%) Gaps:101/373 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHKFR 71
            ||||    ..|:|...||...:.   .|||:|..:..::|...:.|...:|.:|::.|.:|.|||
  Fly     6 CRIC----SRSDAPIDLFGPGNG---HLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFR 63

  Fly    72 ELC-----QESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIGMENIME 131
            :.|     |..||      ::.:.|...||.:          |||..:|                
  Fly    64 QRCIIAEKQNLER------IECDSKDCSTDPI----------IYEDIDD---------------- 96

  Fly   132 EPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGA 196
                            :.:..:||| .:|.|...|   .|:....|...              ..
  Fly    97 ----------------NQIESELDE-SILCPEVKD---LPMPSAEKVSA--------------PT 127

  Fly   197 SSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEI--C 259
            |..|.:|......|               .:|..||.|.:.::....|..||...|.|.|..  |
  Fly   128 SLNHQKSIGGGTGP---------------YVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNC 177

  Fly   260 SKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNV 324
            .:|||...||..|.|:||||:|::|.||.|.|:...:...|.|.|.|||.:.|.||.|:|..|..
  Fly   178 ERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGC 242

  Fly   325 LKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHHKNE 372
            |:.|.:.|...:...|.||.|.|.|...|      |||..:.||.:.|
  Fly   243 LRKHKMIHVDARNHYCYVCQKHFKRISHL------MTHLSSNIHKRKE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 25/78 (32%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 8/25 (32%)
COG5048 249..>362 CDD:227381 44/114 (39%)
C2H2 Zn finger 256..276 CDD:275368 9/21 (43%)
zf-H2C2_2 268..292 CDD:290200 13/23 (57%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 11/21 (52%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 8/23 (35%)
C2H2 Zn finger 340..362 CDD:275368 8/21 (38%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 23/76 (30%)
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 9/21 (43%)
zf-H2C2_2 186..211 CDD:290200 14/24 (58%)
UFD2 <256..>294 CDD:227443 13/35 (37%)
C2H2 Zn finger 258..280 CDD:275368 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.