DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG31388

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:456 Identity:92/456 - (20%)
Similarity:167/456 - (36%) Gaps:133/456 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCRICLTEDINSEAMAP-LFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHK 69
            :||.|  ..:...|:|. |||.:.:   .::|:||.:.:::|.....:|..:|..|...|..|..
  Fly     4 ICRTC--SRMADPAVAKNLFDPSSS---SVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAID 63

  Fly    70 FRELCQESERTFATNVVKAEMKSEP--------TDEVPHVVA---------DNIEYIYE------ 111
            ||.:|.|::......:.:.|.:.|.        .|:.|..::         |.:::|::      
  Fly    64 FRRVCIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDK 128

  Fly   112 -----------SANDFIDGVED---------------------DIGMENIMEEPLEDGVG--ETS 142
                       :..::::..:.                     |:|: :...||..:.:.  :||
  Fly   129 NTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGL-SPESEPESEAIDNRDTS 192

  Fly   143 QAYETSTV------VD----------DLDEDDLLVPNSTDSDYQ--------------PI-ERCR 176
            .::..|..      ||          |:..|...|.:..|..::              |: ..|.
  Fly   193 SSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSCT 257

  Fly   177 KAKVRKTRMTKRGRGRPRGASSGHPRSFSEE------RPPVQASFKSSPEVSSTNIMCEICGNIY 235
            |.|                 |..|.....|.      |||            ::..:|.|||...
  Fly   258 KCK-----------------SQFHNHILLETHKQRCLRPP------------ASQHVCHICGKHL 293

  Fly   236 SKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKY-CNRSFADRSSNIR 299
            :....|..|:.||...:..||:.||.||...:||..|.:.||.|:|::|:| |.::|...|:...
  Fly   294 TTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSM 358

  Fly   300 HERTH--TNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTH 362
            |||.|  .::|.:.|..|.|::...:..:.|...|...:...|.:|..:|........||.:..|
  Fly   359 HERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAH 423

  Fly   363 Q 363
            :
  Fly   424 K 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 21/75 (28%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 9/23 (39%)
COG5048 249..>362 CDD:227381 33/115 (29%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-H2C2_2 268..292 CDD:290200 10/24 (42%)
C2H2 Zn finger 284..304 CDD:275368 8/20 (40%)
zf-H2C2_2 299..321 CDD:290200 8/23 (35%)
C2H2 Zn finger 312..332 CDD:275368 4/19 (21%)
zf-H2C2_2 325..349 CDD:290200 5/23 (22%)
C2H2 Zn finger 340..362 CDD:275368 5/21 (24%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 21/76 (28%)
C2H2 Zn finger 228..254 CDD:275368 2/25 (8%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..363 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368 4/19 (21%)
C2H2 Zn finger 401..419 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.