DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and nom

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:399 Identity:101/399 - (25%)
Similarity:160/399 - (40%) Gaps:122/399 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHKF 70
            :||:|....:..:|: .||....   ::::|:|:.:..|.|..:.|.|.|:|:.|...|.||..|
  Fly     5 VCRVCGRSRLCPKAV-ELFKPGR---QDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIF 65

  Fly    71 RELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIGMENIMEEPLE 135
            |..|...::.:                ||.:.:|.:            |..::..:|        
  Fly    66 RRQCILQQKKW----------------VPLLQSDKV------------GASEEKKVE-------- 94

  Fly   136 DGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPR------ 194
                                      ||...:              |.:.|||.|||||      
  Fly    95 --------------------------PNDPST--------------KKKTTKRRRGRPRMPLEIV 119

  Fly   195 --------GASSGHPRSFSEERPPVQASFKSSPEVSSTNI------------------------- 226
                    .||:|......|...||:.|  :.|:.:.:::                         
  Fly   120 DIVVTNESKASAGESVGGDEFDQPVEIS--NEPDATDSDVNLEEIDLPDEDGLESDHDLPNVQIH 182

  Fly   227 MCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRH-IRVHTGEKPFLCKYCNRS 290
            .|:.||.|.:.:::|..|...|...:|:.|:.|.|:|...|||..| :..||.|.||.|:||:|.
  Fly   183 KCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRR 247

  Fly   291 FADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQ 355
            :.......:|||.|||||||.|..|||||:.:.:||.||..|...:.:.|.||:::||.|..|..
  Fly   248 YFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLAT 312

  Fly   356 HLGTMTHQQ 364
            |..:.||::
  Fly   313 HFISNTHKR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 21/74 (28%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 7/23 (30%)
COG5048 249..>362 CDD:227381 47/113 (42%)
C2H2 Zn finger 256..276 CDD:275368 8/20 (40%)
zf-H2C2_2 268..292 CDD:290200 12/24 (50%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 16/21 (76%)
C2H2 Zn finger 312..332 CDD:275368 10/19 (53%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 340..362 CDD:275368 8/21 (38%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 21/74 (28%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
C2H2 Zn finger 212..261 CDD:275368 20/48 (42%)
zf-H2C2_2 255..278 CDD:290200 16/22 (73%)
C2H2 Zn finger 269..289 CDD:275368 10/19 (53%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.