DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and pita

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster


Alignment Length:483 Identity:113/483 - (23%)
Similarity:190/483 - (39%) Gaps:133/483 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEYMLCRICLTEDINSEAMAPLFDDND--AQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVER 63
            :.|..:||.||||    :.:|.:|::|.  .....|..:|..:.:|::.....:|..:|..|...
  Fly    12 LTEKRVCRFCLTE----QKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLL 72

  Fly    64 LTSAHKFRELCQESE-------------------RTFATNVVKAEM-----KSEPTDEVPHVVAD 104
            ....::|:::|:.:|                   |...|.|...::     |:....|.|..:.:
  Fly    73 FEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLN 137

  Fly   105 NIEYIYESANDFIDGVEDDIGMENIMEEPL----EDGVGETSQAYETSTVVD---DLDEDDLL-- 160
            .:.   :|::..|  :||...:|:.|..|.    ...|...|.|||..  ||   :|..||:.  
  Fly   138 TMA---KSSSQVI--IEDVQVLESAMVTPRTVAGSSPVPRRSHAYELK--VDNNQELSMDDVQSM 195

  Fly   161 ---VPNSTDSDYQPIERCRKAKVRKTRMTKRGRGR-----------PRGAS-------SGHPRSF 204
               :.:..:.::..|.  :||...|.::..:...|           ||.|:       ||:....
  Fly   196 LEDMASELEKEFPDIP--QKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAIV 258

  Fly   205 SE----------ERPPVQASFKSSPEV------------------------SSTNIMCEICGNIY 235
            :|          :..|.:.:.|.:.:|                        .|.:..|.:|...:
  Fly   259 TEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSF 323

  Fly   236 SKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTG---------EKPFL-------- 283
            ..:..|..|...|..|:||||.||||:|...:.|:||.|.||.         |||||        
  Fly   324 FSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKH 388

  Fly   284 -----------CKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKP 337
                       |..|.:|||.:....|||..|:...||.|..|.::||.::.|..|::.|.|::.
  Fly   389 AERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRA 453

  Fly   338 FLCRVCNKTFSRKHQLDQHLGTMTHQQT 365
            :.|:.|:|::...|.|.:||  .||.||
  Fly   454 YPCKYCHKSYMLSHHLSRHL--RTHTQT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 19/95 (20%)
C2H2 Zn finger 228..248 CDD:275368 4/19 (21%)
zf-H2C2_2 240..264 CDD:290200 12/23 (52%)
COG5048 249..>362 CDD:227381 47/140 (34%)
C2H2 Zn finger 256..276 CDD:275368 10/19 (53%)
zf-H2C2_2 268..292 CDD:290200 14/51 (27%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 9/21 (43%)
C2H2 Zn finger 312..332 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 7/23 (30%)
C2H2 Zn finger 340..362 CDD:275368 7/21 (33%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 18/78 (23%)
COG5048 <281..506 CDD:227381 58/201 (29%)
C2H2 Zn finger 288..308 CDD:275368 0/19 (0%)
C2H2 Zn finger 316..336 CDD:275368 4/19 (21%)
zf-H2C2_2 328..353 CDD:290200 13/24 (54%)
C2H2 Zn finger 344..364 CDD:275368 10/19 (53%)
C2H2 Zn finger 372..388 CDD:275370 5/15 (33%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
C2H2 Zn finger 428..448 CDD:275368 6/19 (32%)
C2H2 Zn finger 456..476 CDD:275368 7/21 (33%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.