DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG10321

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:449 Identity:99/449 - (22%)
Similarity:153/449 - (34%) Gaps:145/449 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RICLTEDI-NSEAM-APLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHKF 70
            ::.:.||: .||:. ...|||.|.|  :.:.:||:... ::.|                      
  Fly   383 QVMINEDLTQSESQDHEYFDDLDQQ--QAMDEIEDEEE-QMKP---------------------- 422

  Fly    71 RELCQESERTFATNVVKA---EMKSEPTDEVPHVVADNIEYIYESANDFIDG-VEDDIGMENIME 131
                :|.:.||....::.   ||..:|..|   .:..:.|||.|..:..:.| |:||:.. :|||
  Fly   423 ----EEDQDTFIIEEIQLEDDEMLDDPDGE---EIDQDCEYIGEEQDPHLSGDVDDDLEY-SIME 479

  Fly   132 EP-------------------------------LEDGVGETSQAYETSTVVDDLDEDDLLVPNST 165
            .|                               ||:.|.|.|||..|:        :.|:.|..|
  Fly   480 PPDGETSVDIDQAFMDSEQSHHQQHQEEMQSISLENAVVEFSQATTTT--------EALVGPTMT 536

  Fly   166 DSDYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSS------------ 218
            .|...|             ..||.:.......:|......:.:||...|..||            
  Fly   537 VSSASP-------------TPKRAKRSNHQIPAGVTLEPCDHQPPAAGSTTSSKLAAANSRQLVQ 588

  Fly   219 -----------------------------PEVSSTNIMCEICGNIYSKRAALNIHMRRHM----- 249
                                         ..:.|...:|.:|...:.:...|..||..|.     
  Fly   589 TASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRA 653

  Fly   250 -AEKPFKCEICSKSFAGPSELNRHIRVHTGEKPF-LCKYCNRSFADRSSNIRHERTHTNERPFTC 312
             .:|..:|:||.|||.||..|..|::.|..|... :|..|||:|..::...||.:|| .:|.:.|
  Fly   654 NCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTH-QQRAYCC 717

  Fly   313 --STCGKAFSYSNVLKNHMLTHTGE--KP-FLCRVCNKTFSRKHQLDQHLGTMTHQQTV 366
              :.|.|.||.:..||.|:.....|  .| |.|..|...:.....|..|:.:..|...|
  Fly   718 GVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHVESTDHSAEV 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 13/74 (18%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 10/29 (34%)
COG5048 249..>362 CDD:227381 38/124 (31%)
C2H2 Zn finger 256..276 CDD:275368 10/19 (53%)
zf-H2C2_2 268..292 CDD:290200 8/24 (33%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 9/23 (39%)
C2H2 Zn finger 312..332 CDD:275368 8/21 (38%)
zf-H2C2_2 325..349 CDD:290200 8/26 (31%)
C2H2 Zn finger 340..362 CDD:275368 4/21 (19%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 26/143 (18%)
C2H2 Zn finger 627..647 CDD:275368 5/19 (26%)
C2H2 Zn finger 661..681 CDD:275368 10/19 (53%)
C2H2 Zn finger 690..710 CDD:275368 7/19 (37%)
C2H2 Zn finger 717..740 CDD:275368 8/22 (36%)
C2H2 Zn finger 750..767 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.