| Sequence 1: | NP_650094.1 | Gene: | CG14711 / 41395 | FlyBaseID: | FBgn0037922 | Length: | 377 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102374.1 | Gene: | Zfp787 / 365176 | RGDID: | 1310536 | Length: | 381 | Species: | Rattus norvegicus |
| Alignment Length: | 225 | Identity: | 71/225 - (31%) |
|---|---|---|---|
| Similarity: | 107/225 - (47%) | Gaps: | 39/225 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 133 PLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGRGRPRGAS 197
Fly 198 SGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKS 262
Fly 263 FAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKN 327
Fly 328 HMLTHTGEKPFLCRVCNKTFSRKHQLDQHL 357 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14711 | NP_650094.1 | zf-AD | 6..81 | CDD:285071 | |
| C2H2 Zn finger | 228..248 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 240..264 | CDD:290200 | 9/23 (39%) | ||
| COG5048 | 249..>362 | CDD:227381 | 46/109 (42%) | ||
| C2H2 Zn finger | 256..276 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 268..292 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 284..304 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 299..321 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 312..332 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 340..362 | CDD:275368 | 7/18 (39%) | ||
| Zfp787 | NP_001102374.1 | zf-C2H2 | 66..88 | CDD:395048 | 7/27 (26%) |
| C2H2 Zn finger | 68..88 | CDD:275368 | 7/19 (37%) | ||
| COG5048 | <93..200 | CDD:227381 | 45/105 (43%) | ||
| C2H2 Zn finger | 96..116 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 124..144 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 152..172 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 180..200 | CDD:275368 | 7/18 (39%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | |||
| C2H2 Zn finger | 319..339 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 139 | 1.000 | Inparanoid score | I4420 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||