DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG17568

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:469 Identity:98/469 - (20%)
Similarity:172/469 - (36%) Gaps:123/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRICLTEDINSEAMAPLFDDNDAQC-RELVRKIEEVGSIKLVPLQNIPSMLCYSC---------- 60
            ||:|..:|.:......:.:::.... ..|:..|.:...:::.....:.|:||..|          
  Fly    11 CRLCAKDDAHGNVKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELIDF 75

  Fly    61 VERLTSAHKFRELCQESE-------------RTFA------TNVVK----AEMKSEPTDEVP--- 99
            .|.:|......|:.:.:|             :.|.      |:::|    .||:|:...:.|   
  Fly    76 AEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQKPAEL 140

  Fly   100 -------HVVADNIEYIYESANDFIDGVEDDIGMENIMEEPLEDG---VGETSQAYETSTVVDDL 154
                   ...:..:|....:....:...:.::.||...:|.::.|   :.:.:...:...|:|:|
  Fly   141 LKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLEKNTSQLDMEDVLDEL 205

  Fly   155 DEDDLLVP--NST--------------------DSDYQPI-----------------ERCRKAKV 180
            .:::|..|  :||                    |.|:.|:                 |...:.|.
  Fly   206 PQEELSQPRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAEEKA 270

  Fly   181 RKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHM 245
            ::.||.....|:.....:.:.:....|...::...|    |..|...|:||....|...||.:|.
  Fly   271 KRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVK----VDKTTTTCDICNKTLSSATALKLHK 331

  Fly   246 RR-HMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRS-------------- 295
            .. |...||:.|:.|.|.....:.||.|..|||..:||.|..|...|.:|:              
  Fly   332 EGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIHAEPSF 396

  Fly   296 -SNI------------RHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTF 347
             .||            .|:..||.||...|..||..|..|..||.|:|:|||.:|::|..|.|:|
  Fly   397 VCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSF 461

  Fly   348 S-----RKHQLDQH 356
            :     |.|:|.:|
  Fly   462 ACNANCRSHKLKKH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 14/97 (14%)
C2H2 Zn finger 228..248 CDD:275368 7/20 (35%)
zf-H2C2_2 240..264 CDD:290200 9/24 (38%)
COG5048 249..>362 CDD:227381 45/140 (32%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 7/46 (15%)
zf-H2C2_2 299..321 CDD:290200 9/21 (43%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/28 (43%)
C2H2 Zn finger 340..362 CDD:275368 8/22 (36%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 12/75 (16%)
COG5048 <313..471 CDD:227381 50/157 (32%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 4/19 (21%)
C2H2 Zn finger 398..418 CDD:275368 3/19 (16%)
C2H2 Zn finger 426..446 CDD:275368 9/19 (47%)
zf-H2C2_2 439..463 CDD:290200 12/23 (52%)
C2H2 Zn finger 454..475 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.