DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14711 and sens-2

DIOPT Version :9

Sequence 1:	NP_650094.1	Gene:	CG14711 / 41395	FlyBaseID:	FBgn0037922	Length:	377	Species:	Drosophila melanogaster
Sequence 2:	NP_001285692.1	Gene:	sens-2 / 33957	FlyBaseID:	FBgn0051632	Length:	746	Species:	Drosophila melanogaster

Alignment Length:	141	Identity:	55/141 - (39%)
Similarity:	77/141 - (54%)	Gaps:	1/141 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   228 CEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFA 292
            ||:|...:....:|:.|...|..||.|:|:.|.|.|...|.|:.|:.:|:..:|:.|.||.:.|.
  Fly   538 CELCNKTFGHEVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKRFH 602

  Fly   293 DRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHL 357
            .:|...:|...||.|:|..|..||||||.|:.|..|...|||.|||.|::|:|.|.||..|.:|.
  Fly   603 QKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHK 667

  Fly   358 GTMTHQQTVIH 368
            .|. |....:|
  Fly   668 ETQ-HTDLRVH 677

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14711	NP_650094.1	zf-AD	6..81	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	5/19 (26%)
		zf-H2C2_2	240..264	CDD:290200	9/23 (39%)
		COG5048	249..>362	CDD:227381	47/112 (42%)
		C2H2 Zn finger	256..276	CDD:275368	7/19 (37%)
		zf-H2C2_2	268..292	CDD:290200	7/23 (30%)
		C2H2 Zn finger	284..304	CDD:275368	6/19 (32%)
		zf-H2C2_2	299..321	CDD:290200	11/21 (52%)
		C2H2 Zn finger	312..332	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	12/23 (52%)
		C2H2 Zn finger	340..362	CDD:275368	9/21 (43%)
sens-2	NP_001285692.1	COG5048	<504..672	CDD:227381	53/134 (40%)
		C2H2 Zn finger	509..530	CDD:275368
		zf-H2C2_2	522..545	CDD:290200	3/6 (50%)
		C2H2 Zn finger	538..558	CDD:275368	5/19 (26%)
		zf-H2C2_2	550..575	CDD:290200	10/24 (42%)
		C2H2 Zn finger	566..586	CDD:275368	7/19 (37%)
		zf-H2C2_2	579..603	CDD:290200	8/23 (35%)
		C2H2 Zn finger	594..614	CDD:275368	6/19 (32%)
		zf-H2C2_2	606..631	CDD:290200	11/24 (46%)
		C2H2 Zn finger	622..642	CDD:275368	10/19 (53%)
		zf-H2C2_2	634..657	CDD:290200	11/22 (50%)
		C2H2 Zn finger	650..677	CDD:275368	10/27 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24381
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100