DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG15436

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:399 Identity:108/399 - (27%)
Similarity:158/399 - (39%) Gaps:111/399 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCRICLTEDINSEAMAPLFD----------DNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSC 60
            :||:|:  ||:.: :..:||          :..|||.....|..::.|          .|:|..|
  Fly     4 ICRVCM--DISGK-LVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFS----------EMICPQC 55

  Fly    61 VERLTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIG 125
            .|.:.||:..|:.|:||.:.:..                  |.|             :|:||.: 
  Fly    56 YEDVKSAYGIRQTCEESHQFYCR------------------VRD-------------EGIEDAL- 88

  Fly   126 MENIMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRMTKRGR 190
            ...:.||..|....|.::....|...||         ..:||.....| ||:...:..|      
  Fly    89 CALLEEEDWEISEDEDARIDSASAADDD---------GKSDSKKVAFE-CRECHKKYQR------ 137

  Fly   191 GRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRRHMAEKPFK 255
               :|....|.|:                .:...:..|..|...:..|..|..||:.|.|.||::
  Fly   138 ---KGTFLRHMRT----------------HMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYE 183

  Fly   256 CEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFS 320
            |..|:|:||..|.|..|.|.||||:||.|..|:::|...|...||.|||.:||||.||.|.|.|:
  Fly   184 CSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFT 248

  Fly   321 YSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQH--------------------LGTMTHQQT 365
            ....|.||..:||||:||.|..|.|.|:.|..|.||                    |.:...:..
  Fly   249 RKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHK 313

  Fly   366 VIHHKNERT 374
            ::|:. |||
  Fly   314 LVHNA-ERT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 22/84 (26%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 54/132 (41%)
C2H2 Zn finger 256..276 CDD:275368 9/19 (47%)
zf-H2C2_2 268..292 CDD:290200 11/23 (48%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 14/21 (67%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 9/41 (22%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 22/86 (26%)
C2H2 Zn finger 128..148 CDD:275368 6/44 (14%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 57/143 (40%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
zf-H2C2_2 197..219 CDD:290200 11/21 (52%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 14/24 (58%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 12/23 (52%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 1/19 (5%)
C2H2 Zn finger 324..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.