DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and si:ch1073-224n8.1

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_001921563.1 Gene:si:ch1073-224n8.1 / 327438 ZFINID:ZDB-GENE-030131-5649 Length:573 Species:Danio rerio


Alignment Length:389 Identity:100/389 - (25%)
Similarity:149/389 - (38%) Gaps:90/389 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYMLCRICLTED--INSEAMAPLFDDNDAQCRELVRKIEEVGSIKLV----PLQNIPSMLCYSCV 61
            |:..|.:.:..|  :.:....|:...:...|.::.|..|.|...:.:    | ||.||...:|..
Zfish   200 EFKSCHLSIQADGTVTNSFYDPISVHSSNICSDMNRPGEMVDDSRRLSHTRP-QNPPSHPSFSIK 263

  Fly    62 ERLTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESAND--FIDGVEDDI 124
            |......  .:||.:.             :..||:.         |:..:|..|  ::..||::.
Zfish   264 EEQVPGS--GQLCVQG-------------RDPPTES---------EHSAQSVCDLAYVHVVEEER 304

  Fly   125 GMEN-------IMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRK 182
            |..:       ....|.....|.:|...:.|                  |..|.....|.:..|.
Zfish   305 GSRSHHHPSKPTPPPPSRPQNGPSSSLTDPS------------------SPTQGTSGLRSSAQRD 351

  Fly   183 T----RMTKRGRGRPRGASSGHP--RSFSE-------ERPPVQASFKSSPEVSSTNIMCEICGNI 234
            :    ..|:|..| ..|:|...|  ||.||       |||.                :|..||..
Zfish   352 SPGLGMSTRRSPG-VGGSSPEEPIRRSISELMGEAPGERPH----------------LCLECGKT 399

  Fly   235 YSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIR 299
            :...::|..|:|.|..|||:.|.:|.:.|.....|..|:|:||||||:.|..|...|.......:
Zfish   400 FRLISSLKKHLRIHTGEKPYPCTVCGRRFRESGALKTHLRIHTGEKPYSCSDCGTQFRHLDGLRK 464

  Fly   300 HERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQ 363
            |.||||.|:|:.||.|||..|....||:|...||||:|..|.:|::.|.....|.:||  ..||
Zfish   465 HRRTHTGEKPYVCSICGKRLSRLQHLKHHQRIHTGERPCCCPLCHRGFKDPASLRKHL--RAHQ 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 16/80 (20%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 9/23 (39%)
COG5048 249..>362 CDD:227381 45/112 (40%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..292 CDD:290200 11/23 (48%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
si:ch1073-224n8.1XP_001921563.1 ROS_MUCR <373..>418 CDD:303058 16/60 (27%)
COG5048 389..>453 CDD:227381 25/79 (32%)
C2H2 Zn finger 393..413 CDD:275368 6/19 (32%)
zf-H2C2_2 405..428 CDD:290200 9/22 (41%)
C2H2 Zn finger 421..441 CDD:275368 6/19 (32%)
zf-H2C2_2 433..458 CDD:290200 12/24 (50%)
COG5048 445..>498 CDD:227381 21/52 (40%)
C2H2 Zn finger 449..469 CDD:275368 5/19 (26%)
zf-H2C2_2 462..486 CDD:290200 12/23 (52%)
C2H2 Zn finger 477..497 CDD:275368 9/19 (47%)
zf-H2C2_2 489..513 CDD:290200 10/23 (43%)
C2H2 Zn finger 505..525 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.