DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and CG2712

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster


Alignment Length:494 Identity:119/494 - (24%)
Similarity:186/494 - (37%) Gaps:142/494 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEYMLCRICLTEDINSEAMAPLF----DDNDAQCRELVRKIEEVGSIKLVPLQ-NIPSMLCYSCV 61
            |...|||:|.|.   |....|||    |....:...|...:.....::::..: .:|..:|..||
  Fly     9 PMDALCRVCHTA---SPRCLPLFKPLDDPISGKPATLASILSYCSGLEILEAELFLPHHICPDCV 70

  Fly    62 ERL-------TSAHKFRELCQESERTF-------ATNVVKAEMKSEPTDEVPHVVADN--IEYIY 110
            .:|       .|.|:...:.::|...|       |.| .:|.:.:|..::...|:.|.  .||..
  Fly    71 AKLRLSLEFKRSVHRMDRILRQSHADFCRSKKISAVN-TRARLSTEIPEDFVLVLDDQEVTEYPA 134

  Fly   111 ESAND--FIDGVEDDIGMENIMEEPL--EDGVGETSQAYETS--TVVDDLD-----------EDD 158
            |:..|  .:..||.| ..|:.:|.|:  |:.:....:.:|..  .:|||.|           |..
  Fly   135 ETIRDEEQLLVVESD-EAESRLEAPIVQEERLDIALEQHEDDLCEIVDDPDPEQRRSRLERSEPA 198

  Fly   159 LLVP------------------------NSTDSDYQPIERCRKAK--------------VRKTRM 185
            |..|                        ...|:|: .||.|.:.:              |.|:..
  Fly   199 LQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDH-CIEECLQVEPVLQAKAGEDVYEIVEKSAQ 262

  Fly   186 TK-RGRGRPRGASSGHPRSFSEERPPVQA-----------SFKSSPEV--SSTNIMCEICG---- 232
            |. ..:..|.|:     |.:....|.:|.           |||...::  ::|..:|.|||    
  Fly   263 TSATQKTLPSGS-----RPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFK 322

  Fly   233 ------------------------NIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELNRHI 273
                                    .:|.:.::|..|:..|...|||:|.||.|.....|...:|:
  Fly   323 TRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHM 387

  Fly   274 RVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGK-AFSYSNVLKNHMLTHTGEKP 337
            ..||||||..|..|.|.|...|:.|.|:|.|:.|:|..|..|.| :|..::.|..|||.|:.|:|
  Fly   388 LTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERP 452

  Fly   338 FLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHHKNERTGR 376
            |.|..|.|:|.|:..|            .||.::.:.||
  Fly   453 FGCEQCGKSFKRRISL------------AIHRQSHKAGR 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 19/86 (22%)
C2H2 Zn finger 228..248 CDD:275368 7/47 (15%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 44/113 (39%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..292 CDD:290200 10/23 (43%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 9/22 (41%)
C2H2 Zn finger 312..332 CDD:275368 8/20 (40%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 18/81 (22%)
C2H2 Zn finger 286..306 CDD:275368 3/19 (16%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..362 CDD:275368 3/19 (16%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 34/84 (40%)
zf-H2C2_2 384..407 CDD:290200 11/22 (50%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 12/24 (50%)
C2H2 Zn finger 455..475 CDD:275368 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.