DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14711 and Zkscan4

DIOPT Version :9

Sequence 1:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_038952138.1 Gene:Zkscan4 / 291164 RGDID:1309004 Length:480 Species:Rattus norvegicus


Alignment Length:407 Identity:108/407 - (26%)
Similarity:152/407 - (37%) Gaps:133/407 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KFRELCQESER-------------------TFATNVVKAEMKSEPTDEVPHVVADNIEYIYESAN 114
            :.||||::..|                   |.....::|.::.:..|....||| .:||:....:
  Rat    71 RLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGELQAWVREQHPDSGEEVVA-LLEYLDRQLD 134

  Fly   115 DFIDGVEDDIGMENIMEEPLEDGVGETSQAYETSTVVDDLDEDDLLVPNSTDS------------ 167
                            |.|.:...||.|:......|.        ||.:|.||            
  Rat   135 ----------------ETPPQVPTGEWSRELLCCKVA--------LVTSSQDSQSSHSQAMKSLF 175

  Fly   168 --DYQPIERCRKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERP----------PVQASFKSSPE 220
              :.|....|...:.|...|....||.|..      ..:.|::|          .||.|  :|.|
  Rat   176 KHESQESLECSPLQARGLEMKPETRGLPLA------EEYKEQKPEQTVWFLGEDTVQIS--TSTE 232

  Fly   221 VS---------------STNIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSELN 270
            .|               :....|..||..:::.:.|..|.|.|..|||::||.|.|:|.|.|.|.
  Rat   233 ASEQEGKLQTTQKNATGNRRFYCHECGKSFAQSSGLTKHKRIHTGEKPYECEDCGKTFIGSSALV 297

  Fly   271 RHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTGE 335
            .|.||||||||:.|:.|.:.|:..|:.|:|:||||.|:|:.|..|||.|:.|..|..|...||||
  Rat   298 IHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFTQSCSLLEHHKIHTGE 362

  Fly   336 KPFLCRVCNKTFSRKHQLDQH--------------------------LG---------------- 358
            |||.|.:|.|.|.|...|.:|                          ||                
  Rat   363 KPFQCNLCGKAFRRSSHLLRHQRIHGDKAAPKLLHGETWEGQSRVASLGDIVEAPETYQCNECER 427

  Fly   359 TMTHQQTVIHHKNERTG 375
            :.|..:::|.||...||
  Rat   428 SFTRSRSLIEHKKIHTG 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 5/30 (17%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 11/23 (48%)
COG5048 249..>362 CDD:227381 56/154 (36%)
C2H2 Zn finger 256..276 CDD:275368 10/19 (53%)
zf-H2C2_2 268..292 CDD:290200 12/23 (52%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 340..362 CDD:275368 9/63 (14%)
Zkscan4XP_038952138.1 SCAN 47..156 CDD:128708 19/109 (17%)
zf-C2H2 253..275 CDD:395048 6/21 (29%)
C2H2 Zn finger 255..275 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:404364 11/21 (52%)
zf-C2H2 281..303 CDD:395048 10/21 (48%)
C2H2 Zn finger 283..303 CDD:275368 10/19 (53%)
COG5048 <307..471 CDD:227381 44/138 (32%)
C2H2 Zn finger 311..331 CDD:275368 7/19 (37%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
C2H2 Zn finger 367..387 CDD:275368 7/19 (37%)
C2H2 Zn finger 422..442 CDD:275368 4/19 (21%)
C2H2 Zn finger 450..470 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.